Tap / click on image to see more RealViewsTM
Sale Price $4.41.  
Original Price $4.90 Comp. value
per sticker
You save 10%

Fun Pink Bride Groom Wedding Planner Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 4" x 4" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 4" L x 4.5" W
  • Design Area: 4" L x 4" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Fun Pink Bride Groom Wedding Planner Sticker

Fun Pink Bride Groom Wedding Planner Sticker

Fun Pink Bride Groom Wedding Planner sticker set

Customer Reviews

4.2 out of 5 stars rating191 Total Reviews
139 total 5-star reviews11 total 4-star reviews10 total 3-star reviews9 total 2-star reviews22 total 1-star reviews
191 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
4 out of 5 stars rating
By Word S.December 10, 2019Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Came out just as ordered, however the "3x3" inch size is misleading. The word I chose, "coffee", was smaller than my thumb nail. The outer area of the stickr was 3x3 as the description stated, but I don't think there was a way for me to know the actual sticker with the word would be SOOOO small. For future buyers - the sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space. The sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space.

Tags

Custom-Cut Vinyl Stickers
girlyfancyplannerstickertrendyweddingcakebridegroomfloralpink
All Products
girlyfancyplannerstickertrendyweddingcakebridegroomfloralpink

Other Info

Product ID: 256902188980148030
Created on: 8/15/2022, 12:13 PM
Rating: G