Tap / click on image to see more RealViewsTM
Sale Price $4.17.  
Original Price $4.90 Comp. value
per sticker
You save 15%

Fun White Bride Groom Wedding Planner Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 4" x 4" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 4" L x 4.5" H
  • Design Area: 4" L x 4" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Fun White Bride Groom Wedding Planner Sticker

Fun White Bride Groom Wedding Planner Sticker

Fun White Bride Groom Wedding Planner sticker set

Customer Reviews

4.2 out of 5 stars rating184 Total Reviews
132 total 5-star reviews11 total 4-star reviews10 total 3-star reviews9 total 2-star reviews22 total 1-star reviews
184 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
4 out of 5 stars rating
By Word S.December 10, 2019Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Came out just as ordered, however the "3x3" inch size is misleading. The word I chose, "coffee", was smaller than my thumb nail. The outer area of the stickr was 3x3 as the description stated, but I don't think there was a way for me to know the actual sticker with the word would be SOOOO small. For future buyers - the sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space. The sticker is high quality, arrived on time, and is what I ordered - just be sure you really look at the size of your font in relation to the 3x3 space.

Tags

Custom-Cut Vinyl Stickers
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral
All Products
girlyfancyplannerstickertrendywhiteweddingcakebridegroomfloral

Other Info

Product ID: 256170842373066873
Created on: 8/15/2022, 11:47 AM
Rating: G