• Events
Tap / click on image to see more RealViewsTM
Sale Price $4.08.  
Original Price $4.80 Comp. value
per bumper sticker
You save 15%

Funny Keep Honking Vinyl Bumper Sticker

Qty:

    Other designs from this category

    About Bumper Stickers

    Sold by

    Style: Bumper Sticker

    Entertain the cars sitting behind you in traffic with a custom bumper sticker. Make your car a reflection of you and your personality, show off your particular politics, or brag about your honor roll child! Get your point across with this quality bumper sticker that will outlast heavy rain, intense sunlight, and the most severe of traffic jams.

    • Dimensions: 3"l x 11"w
    • Made from durable vinyl with a strong adhesive back that will hold up under the most severe of conditions
    • 100% weatherproof
    • Printed with water-resistant ink that won’t fade or run

    About This Design

    Funny Keep Honking Vinyl Bumper Sticker

    Funny Keep Honking Vinyl Bumper Sticker

    Add some sarcasm to your ride with our "Keep Honking, I Love Meaningless Feedback" vinyl bumper sticker – the perfect way to express your dry wit while stuck in traffic. This funny bumper sticker is ideal for drivers who appreciate a little roadside humor and aren’t afraid to show it. Crafted from durable, weatherproof vinyl, this high-quality car sticker is designed to withstand sun, rain, and whatever else the road throws at it. Whether you’re commuting, road-tripping, or just parked at the grocery store, this funny vinyl decal will definitely turn heads and spark a few chuckles. Perfect for: 🚗 Cars, trucks, and SUVs 💻 Laptops, water bottles, toolboxes 🎁 Gag gifts, stocking stuffers, or white elephant exchanges Product Features: Bold black & white design for maximum readability Easy peel-and-stick application Removable without residue Measures approx. 8" x 3" Show the world you’ve got a sense of humor (and a little bit of sass) with this hilarious bumper sticker. Because let’s face it—honking rarely helps, but sarcasm always does.

    Customer Reviews

    4.8 out of 5 stars rating3.6K Total Reviews
    3120 total 5-star reviews319 total 4-star reviews61 total 3-star reviews36 total 2-star reviews40 total 1-star reviews
    3,576 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Michelle M.July 6, 2020Verified Purchase
    Bumper Sticker
    Creator Review
    Great sticker. Purchased to place it in the window of our business and now one another to place it our business delivery truck too. Like the size. Nice job and fairly priced.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By AnonymousMay 4, 2026Verified Purchase
    Bumper Sticker
    Can't wait to stick it on! Great tool to OPEN PEOPLE 'S EYES! COMING QUICK!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Ross L.June 22, 2025Verified Purchase
    Bumper Sticker
    I had this sticker on one of my trucks in the 1980s. I still drive that way. I needed this and found it on your site.

    Tags

    Bumper Stickers
    funnybumperstickersarcasticcardecalvinylkeephonkingwitty
    All Products
    funnybumperstickersarcasticcardecalvinylkeephonkingwitty

    Other Info

    Product ID: 256615977567618302
    Created on: 6/1/2025, 5:01 AM
    Rating: G