Tap / click on image to see more RealViewsTM
Sale Price $18.02.  
Original Price $21.20 Comp. value
per shirt
You save 15%

Future Doctor Baby Bodysuit

Qty:
Baby Jersey Bodysuit
+$3.40
+$3.40
-$2.85
White
Classic Printing: No Underbase
Vivid Printing: White Underbase
+$3.65
+$3.65
+$3.65
+$3.65

Other designs from this category

About T-Shirts

Sold by

Style: Baby Jersey Bodysuit

Not all baby bodysuits are created equal – this popular style is a must-have for your precious little bundle. The neckband is designed for easy on-and-off and a three-snap closure makes diaper changes a cinch. Personalize it with a custom image or message or dress it up with a cute pair of socks and hat or hair accessory. There's no wrong way to wear this super soft bodysuit.

Size & Fit
  • Standard fit
  • Garment is unisex sizing
  • Flatlock seams, reinforced three snap closure
  • Fits true to size
Fabric & Care
  • 4.5 oz., 100% combed ring spun cotton (Heather is 93/7) jersey
  • Double-needle ribbed binding on all openings
  • EasyTear™ label
  • White is sewn with 100% cotton thread
  • Machine washable. Washing before first use is recommended

Fully committed to providing high quality and safe products, all Zazzle baby products are Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available in side seam.

About This Design

Future Doctor Baby Bodysuit

Future Doctor Baby Bodysuit

Future Doctor with stethoscope motif. Nice gifts!

Customer Reviews

4.6 out of 5 stars rating2.5K Total Reviews
1896 total 5-star reviews402 total 4-star reviews98 total 3-star reviews42 total 2-star reviews36 total 1-star reviews
2,474 Reviews
Reviews for similar products
5 out of 5 stars rating
By Karen L.June 17, 2023Verified Purchase
Baby Jersey Bodysuit, Light Blue, 6 to 12 Month
Zazzle Reviewer Program
I love this onesie, it's adorable! The material is amazing so soft and the color is a perfect sky blue. When my daughter-in asked me to help with her Baby Shower, I was thrilled. It was co-ed & the theme was Cookie Monster. I had no idea that the whole world was after that big blue Monster. Thank goodness for Zazzle, I got most of the party supplies here. Then I found this onesie! They made my customization so easy. The colors are awesome. I wrote the word "Loved" across the bottom of the Cookie Monster in red letters when I was putting it together. I saw the preview & liked it. But to see it in person, OH, it was fantastic, they do exceptional work! I am so glad that I found this onesie/bodysuit. The production time and shipping were exactly what I was told, which made it easy to plan the party. Packaging was nice as well. If you are looking at this product, look no further, I highly recommend it! I'm certain that I'll be back to "design" whatever my new Grandson "needs.". The printing on the onesie/bodysuit is crisp, and clean. With perfect colors that blend well with the blue background of the basic material. We are so happy with how it came out.
5 out of 5 stars rating
By Karen W.December 13, 2023Verified Purchase
Baby Jersey Bodysuit, White, Newborn
Zazzle Reviewer Program
I appreciate the inclusion for all families. Perfect gift for family member and her partner as they anticipate a baby! Nice color combination.
5 out of 5 stars rating
By Madi B.March 4, 2020Verified Purchase
Baby Jersey Bodysuit, Pink, Newborn
Zazzle Reviewer Program
I bought this for my granddaughter to give to my daughter at her baby shower. So she hasn’t seen it yet but I cannot wait! The baby is due in April so I assume it is true to size :-) Also I feel the price was well worth it! The printing turned out absolutely perfect.

Tags

T-Shirts
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower
All Products
doctorfuture doctorphysicianmedicalchildrenkidsinfantshospitalnew babybaby shower

Other Info

Product ID: 235157508766142999
Created on: 10/14/2021, 4:00 PM
Rating: G