Tap / click on image to see more RealViewsTM
Sale Price $19.26.  
Original Price $22.65 Comp. value
per shirt
You save 15%

Gamer Birthday Design, Level Up Next Level Achieve T-Shirt

Qty:
Basic Dark T-Shirt
-$1.30
+$9.40
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark color t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 6’2” and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Gamer Birthday Design, Level Up Next Level Achieve T-Shirt

Gamer Birthday Design, Level Up Next Level Achieve T-Shirt

Gamer birthday design | Level Up Next Level achieved. Games, gaming & gamer designs by drosoman. This motif is designed in a retro gaming look. It pays tribute to gaming. Great for lovers of video games. A cool birthday gift for all gamers who like to complete levels. A great for boys, girls, gamers, nerds and geeks. A great gift idea for birthdays, Easter or Christmas.

Customer Reviews

4.7 out of 5 stars rating31.7K Total Reviews
24862 total 5-star reviews4877 total 4-star reviews1082 total 3-star reviews482 total 2-star reviews445 total 1-star reviews
31,748 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Dark haired male wore adult large and 5’9”, 110# female wore adult medium . Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back.
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Grandma wore adult large with long sleeve shirt underneath. Tall girl adult medium. Dark haired male adult large. Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back.
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Dark haired male wearing adult large and female wearing adult medium. Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back. They printed random cupcake image I downloaded from internet with no problems! Looked perfect! Front design was stock from zazzel.

Tags

T-Shirts
greatgamingbirthdaygamersgiftlevelgamergamesgeeksidea
All Products
greatgamingbirthdaygamersgiftlevelgamergamesgeeksidea

Other Info

Product ID: 235991185885227703
Created on: 4/6/2022, 7:33 PM
Rating: G