Tap / click on image to see more RealViewsTM
Sale Price $7.95.  
Original Price $9.35 Comp. value
per set of 3 sheets
You save 15%

Garden Produce Wrapping Paper | Aprons & Tomatoes

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 19" x 29"

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customizable! Mix and match designs to create unique combinations
  • Dimensions: (3) 19.5" x 28.5" sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

Garden Produce Wrapping Paper | Aprons & Tomatoes

Garden Produce Wrapping Paper | Aprons & Tomatoes

Garden Produce Wrapping Paper | Aprons & Tomatoes Fresh, charming, and full of farm-to-table personality. This kitchen-themed wrapping paper features my signature apron motif paired with vine-ripe tomatoes — the perfect choice for foodie gifts, homemade bakes, pantry presents, garden produce, and kitchen-lover celebrations. Ideal for: • food hampers, cooking gifts, teacher thank-yous • bakery boxes, kitchen accessories, home-grown produce • garden-to-table events, craft fairs, and boutique packaging • matching with the coordinating favor boxes, tags, and bags in my Garden to Table | Orchard & Produce Packaging collection Printed to order with worldwide shipping. Love this look? Follow my store thepapercraftstudio on Zazzle to see new releases — or simply add to cart now.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
974 total 5-star reviews47 total 4-star reviews18 total 3-star reviews4 total 2-star reviews23 total 1-star reviews
1,066 Reviews
Reviews for similar products
5 out of 5 stars rating
By Nicky B.April 21, 2026Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
Creator Review
Gorgeous soft coastal colours and elegant striped design. The quality is excellent and wraps beautifully — perfect for a Hamptons-style gift. Makes any present feel extra special.
5 out of 5 stars rating
By C L.November 8, 2021Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
Zazzle Reviewer Program
This is a great heavy weight paper. No peeking through with this paper. Grid lines on the back for clumsy cutters like me. Designs are pretty but larger than I expected. Printing quality is great. As is the blue color…..I just love it!!
5 out of 5 stars rating
By Victoria B.December 27, 2020Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
Creator Review
I am extremely satisfied with my product. Everyone that received a gift wrapped with these design loved the customized wrapping paper. The printing turned out well.

Tags

Wrapping Paper Sheet Sets
recipebookgiftwrapkitchenthemegiftwrapvegetableloversgiftwrappingtomato harvest gift wrappingfarmhouse kitchen packagingrecipe book gift wrappinggarden gift wrapfoodie birthday gift ideasboutique elegant gift wraphomemade kitchen goodness
All Products
recipebookgiftwrapkitchenthemegiftwrapvegetableloversgiftwrappingtomato harvest gift wrappingfarmhouse kitchen packagingrecipe book gift wrappinggarden gift wrapfoodie birthday gift ideasboutique elegant gift wraphomemade kitchen goodness

Other Info

Product ID: 256336844799673433
Created on: 1/16/2026, 2:32 AM
Rating: G