Tap / click on image to see more RealViewsTM
Sale Price $21.92.  
Original Price $24.35 Comp. value
per roll
You save 10%

Gift Wrap - Two Kittens

4.7 out of 5 stars rating
4079 Total Reviews
|
by
Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 60lb, text weight matte paper
  • Softer surface with dull finish - ideal for color contrasts
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section

About This Design

Gift Wrap - Two Kittens

Gift Wrap - Two Kittens

This gift wrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4.1K Total Reviews
3400 total 5-star reviews379 total 4-star reviews116 total 3-star reviews74 total 2-star reviews110 total 1-star reviews
4,079 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nancy G.August 22, 2020Verified Purchase
Wrapping Paper, Glossy
Zazzle Reviewer Program
I am making a line of mini (27 inches) 1950's retro dresses. I have used this paper and overlaid it with with Sanwa Tissue paper airbrushed to match. I am pleased with the way it turned out and now have ordered other papers to use in my paper dress collection. The color was solid and well absorbed
5.0 out of 5 stars rating
5 out of 5 stars rating
By Devona F.August 4, 2025Verified Purchase
Wrapping Paper, Matte
This is so adorable! Colors are vibrant! So worth the money for wrapping paper! It’s thick and strong. Love that you can personalize the names anyway you want. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tammy K.February 16, 2026Verified Purchase
Wrapping Paper, Matte
Was a hit at my baby granddaughters baby shower. I will be doing this for each birthday from now on. .

Tags

Wrapping Paper
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby
All Products
giftwrapgiftwrapvchdgirlkittenkittenskittycatbaby

Other Info

Product ID: 256780920773533187
Created on: 6/9/2016, 1:30 PM
Rating: G