Tap / click on image to see more RealViewsTM
Sale Price $20.70.  
Original Price $24.35 Comp. value
per roll
You save 15%

Giftwrap: Jolly Santa Wrapping Paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 60lb, text weight matte paper
  • Softer surface with dull finish - ideal for color contrasts
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section

About This Design

Giftwrap:  Jolly Santa Wrapping Paper

Giftwrap: Jolly Santa Wrapping Paper

This giftwrap was designed with free public domain vintage artwork.

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3370 total 5-star reviews374 total 4-star reviews113 total 3-star reviews72 total 2-star reviews104 total 1-star reviews
4,033 Reviews
Reviews for similar products
5 out of 5 stars rating
By Devona F.August 4, 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
This is so adorable! Colors are vibrant! So worth the money for wrapping paper! It’s thick and strong. Love that you can personalize the names anyway you want. .
5 out of 5 stars rating
By Nancy G.August 22, 2020Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
I am making a line of mini (27 inches) 1950's retro dresses. I have used this paper and overlaid it with with Sanwa Tissue paper airbrushed to match. I am pleased with the way it turned out and now have ordered other papers to use in my paper dress collection. The color was solid and well absorbed
5 out of 5 stars rating
By lynda m.November 28, 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Personalized wrapping paper was PERFECT for a baby's shower gift ! Carried out the theme of the party 100%. Everyone was very impressed !!! Rate this wrapping paper top quality. Perfect looks amazing ! Very pleased.

Tags

Wrapping Paper
santajollychristmasxmasvchdgiftwrapwrappaperwrapping
All Products
santajollychristmasxmasvchdgiftwrapwrappaperwrapping

Other Info

Product ID: 256561890783440174
Created on: 8/21/2018, 3:17 PM
Rating: G