Tap / click on image to see more RealViewsTM
Sale Price $2.52.  
Original Price $2.80 Comp. value
per sticker
You save 10%

Gingerbread Cookie / Kangaroo Sticker

Qty:
  1. Sticker Sheet Size

  2. Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Gingerbread Cookie / Kangaroo Sticker

Gingerbread Cookie / Kangaroo Sticker

Adorable gingerbread cookie art — use alone or combine with all stickers in the collection to create an animal parade. Each “cookie” in gingerbread colors complete with “icing” and candy pearl eyes. Enjoy at Christmastime or anytime! By artist and cookie-lover L Diane Johnson.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
905 total 5-star reviews68 total 4-star reviews27 total 3-star reviews32 total 2-star reviews98 total 1-star reviews
1,130 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mile C.December 17, 2024Verified Purchase
The Dunkadelic-Dunkman Vinyl Stickers are amazing in quality and printing of the logo. Zazzle is always 5-stars with their products for The "Charm'tastic Mile" of Baltimore.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra S.July 10, 2024Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.

Tags

Custom-Cut Vinyl Stickers
kids giftsstocking stuffersplaygamesanimalschildrenstickiestoyschristmas decoraustralia
All Products
kids giftsstocking stuffersplaygamesanimalschildrenstickiestoyschristmas decoraustralia

Other Info

Product ID: 256026043687211303
Created on: 3/3/2024, 12:27 PM
Rating: G