Tap / click on image to see more RealViewsTM
Sale Price $4.23.  
Original Price $4.70 Comp. value
per magnet
You save 10%

Glitch: achievement bowser magnet

Qty:
Circle
+$1.75
+$0.80
1.25 Inch
+$0.85
+$1.60

Other designs from this category

About Magnets

Sold by

Shape: Circle

Give your fridge a personality upgrade. Upload a photo, design, or logo and turn it into a magnet that actually looks good up there.

  • Available in 3 sizes: 1.25", 2.25", and 3" diameter
  • USA-made with recycled domestic steel
  • Smooth glossy mylar finish, scratch and UV-resistant
  • Printed on FSC-certified recycled paper
  • Standard fridge-strength magnet
  • Also available in square or rectangle

About This Design

Glitch: achievement bowser magnet

Glitch: achievement bowser magnet

Glitch: achievement bowser This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating6.9K Total Reviews
6140 total 5-star reviews570 total 4-star reviews119 total 3-star reviews47 total 2-star reviews39 total 1-star reviews
6,915 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Faye R.February 2, 2021Verified Purchase
Magnet, Style: Circle, Size: 2.25 Inch
Creator Review
The heart magnet is for everyone-valentines day -birthdays. Every day any holiday -use fo pin teacher notes or kid photos or even your pet photos. Was great unique design with a great print buy many. Resell at yur own business or give for rewards. Excellent print on a great magnet. I would definitely buy this again.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Steve G.June 14, 2022Verified Purchase
Magnet, Style: Circle, Size: 2.25 Inch
Creator Review
Well Designed High Quality Magnet. Colors are Vibrant Clear Excellent good size Diameter Circumference Fonts Red Folio Bold Clover Green Outline Puffy White Interior Image
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michael T.September 2, 2016Verified Purchase
Magnet, Style: Circle, Size: 3 Inch
Creator Review
The magnets are very well made and the magnet on the back of the design takes up most of the surface area which results in a strong bond with your fridge. If you are using this to hold up papers, shopping lists, etc, it does an excellent job. I was very pleased with how this turned out. The lines are sharp, the design is clear and a clear protective coating or cover keeps the design well protected so if needed it can be wiped clean without damaging the design. I would highly recommend.

Tags

Magnets
achievementbowserglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementbowserglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 147699953320672619
Created on: 10/6/2014, 4:18 PM
Rating: G