Tap / click on image to see more RealViewsTM
Sale Price $21.47.  
Original Price $25.25 Comp. value
per towel
You save 15%

Glitch: achievement bubble tea aficionado towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 16" x 24"

Brighten up any kitchen with new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram, or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 16" x 24"
  • 80% durable woven polyester/ 20% polyamide blend microfiber
  • White-colored back-side is non-customizable
  • Machine washable
  • Imported, printed in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 24". For best results please add 5/7" bleed.

About This Design

Glitch: achievement bubble tea aficionado towel

Glitch: achievement bubble tea aficionado towel

Glitch: achievement bubble tea aficionado This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1011 total 5-star reviews118 total 4-star reviews37 total 3-star reviews13 total 2-star reviews16 total 1-star reviews
1,195 Reviews
Reviews for similar products
5 out of 5 stars rating
By Corinne D.February 7, 2018Verified Purchase
Kitchen Towel
Creator Review
My photos don’t do the colors of my gorgeous kitchen towel justice. It’s absolutely beautiful! The printing is gorgeous!
5 out of 5 stars rating
By Donald M.February 3, 2019Verified Purchase
Kitchen Towel
Creator Review
Ecstatic, Eccentric, Eclectic - Excellent, absorbent kitchen towels with vibrant designs. Excellent! Rich pure colors.
5 out of 5 stars rating
By Dee A.March 12, 2023Verified Purchase
Kitchen Towel
Creator Review
Zazzle's kitchen towels put the fun in functional! The waffle weave is absorbent. They are on the thinner side, and I like that because they're pliable and dry quickly. Impressive printing, colors are vibrant and true to expectations. Great detail, too.

Tags

Kitchen Towels
achievementbubbleteaaficionadoglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementbubbleteaaficionadoglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 197627184993330891
Created on: 10/7/2014, 9:21 AM
Rating: G