Tap / click on image to see more RealViewsTM
Sale Price $36.00.  
Original Price $42.35 Comp. value
per roll
You save 15%

Glitch: achievement curious george wrapping paper

Qty:

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Glossy Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and different five sizes, our wrapping paper has all of your gift wrapping needs covered - because the presentation matters just as much as the present!

  • 64lb, print quality glossy paper
  • Ideal for printing photos
  • Full color edge to edge printing
  • Width: 29 inches
  • Length: Multiple choices from 6 feet - 60 feet
  • Each roll up to 15 feet in length; Lengths greater than 15 feet shipped as multiple 15 foot rolls
  • Length guide:
    • 6 foot roll wraps 3 shirt-sized boxes
    • 15 foot roll wraps 9 shirt-sized boxes
    • 30 foot roll wraps 18 shirt-sized boxes
    • 45 foot roll wraps 27 shirt-sized boxes
    • 60 foot roll wraps 36 shirt-sized boxes
  • Printed in USA
  • Designable area is 36" x 30", but is scaled down uniformly and printed at 34.8" x 29"
  • Please note: Designs are tiled after first 34.8" x 29" printed section.

About This Design

Glitch: achievement curious george wrapping paper

Glitch: achievement curious george wrapping paper

Glitch: achievement curious george This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3319 total 5-star reviews373 total 4-star reviews110 total 3-star reviews68 total 2-star reviews86 total 1-star reviews
3,956 Reviews
Reviews for similar products
5 out of 5 stars rating
By Devona F.August 4, 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
This is so adorable! Colors are vibrant! So worth the money for wrapping paper! It’s thick and strong. Love that you can personalize the names anyway you want. .
5 out of 5 stars rating
By Nancy G.August 22, 2020Verified Purchase
Wrapping Paper, Glossy Wrapping Paper
Zazzle Reviewer Program
I am making a line of mini (27 inches) 1950's retro dresses. I have used this paper and overlaid it with with Sanwa Tissue paper airbrushed to match. I am pleased with the way it turned out and now have ordered other papers to use in my paper dress collection. The color was solid and well absorbed
5 out of 5 stars rating
By lynda m.November 28, 2020Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Personalized wrapping paper was PERFECT for a baby's shower gift ! Carried out the theme of the party 100%. Everyone was very impressed !!! Rate this wrapping paper top quality. Perfect looks amazing ! Very pleased.

Tags

Wrapping Paper
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256511350431932487
Created on: 10/7/2014, 12:51 PM
Rating: G