Tap / click on image to see more RealViewsTM
Sale Price $37.89.  
Original Price $42.10 Comp. value
per set of six
You save 10%

Glitch: achievement first alph emblem coaster

Qty:

    Other designs from this category

    About Cork Coasters

    Sold by

    Style: Hard Plastic coasters with cork back - set of 6

    Decorate your home with custom coasters! Made with high-gloss plastic and a non-skid cork backing, these coasters display your photos and designs with vivid and sharp colors. Perfect for hot and cold drinks, custom coasters are a great complement to any table or surface.

    • Dimensions: 3.8" x 3.8"
    • Coasters come in sets of 6
    • High gloss plastic with non-skid cork backing
    • Easy wipe-clean surface
    Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.2" x 3.2". For best results please add 1/8" bleed.

    About This Design

    Glitch: achievement first alph emblem coaster

    Glitch: achievement first alph emblem coaster

    Glitch: achievement first alph emblem This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating404 Total Reviews
    364 total 5-star reviews27 total 4-star reviews6 total 3-star reviews5 total 2-star reviews2 total 1-star reviews
    404 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By K.September 14, 2019Verified Purchase
    Hard Plastic coasters with cork back - set of 6
    Zazzle Reviewer Program
    Order was received in a timely fashion, and securely packaged. Upon opening, I found each coaster, which as designed to my liking, to be colorful, durable and perfect for my Sunday Brunch with my Sistah-Gals! The coasters matched our tie-dye theme to a T... Matched with our wine glasses and table settings... Great parting gift for the evening! Definitely, would order again... If not coasters, preferably another customized souvenir... This is an item that I'd recommend for any special occasion or event. A memorable parting souvenir, after a spectacular time with family, friends or co-workers. Happily satisfied with the overall coaster: Bright Vibrant Colors; Accurate print & fonts as chosen; Sturdy material, which will last for a long time; Easy to clean with a wipe or two (don't intend on washing the bottom, which is cork)...
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Fanitsa P.January 22, 2017Verified Purchase
    Hard Plastic coasters with cork back - set of 6
    Creator Review
    Modern design with old timey astrolabe and telescope. Browns, greens, and earthy tones. Adds character to a room. Can be used as coaster or as decoration. Excellent printing quality.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Joy B.March 31, 2020Verified Purchase
    Hard Plastic coasters with cork back - set of 6
    Zazzle Reviewer Program
    These coasters are great. They are very durable and light weight. The printing came out perfect. The picture looks exactly like its supposed to. Very bright and vibrant colors!

    Tags

    Cork Coasters
    achievementfirstalphemblemglitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    achievementfirstalphemblemglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 163389945369715017
    Created on: 10/13/2014, 12:41 PM
    Rating: G