Tap / click on image to see more RealViewsTM
Sale Price $24.80.  
Original Price $27.55 Comp. value
per shirt
You save 10%

Glitch: achievement forgey laforge T-Shirt

Qty:
Basic T-Shirt
+$10.80
+$26.80
+$11.75
Black
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft - a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5’7” and is wearing a small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge T-Shirt

Glitch: achievement forgey laforge This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating14.9K Total Reviews
10598 total 5-star reviews2865 total 4-star reviews833 total 3-star reviews391 total 2-star reviews259 total 1-star reviews
14,946 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By eunice y.October 21, 2021Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
This Product Included Many Of My Immediate Family Members & We All Love The Excellent Quality Work Put Into Our T-Shirts & The Pricing!!! As Always Zazzle Does Excellent Quality Work On Everything We Have Ever Ordered Including Our Past Orders Our Beautiful Blankets!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Yuliya U.May 10, 2022Verified Purchase
Basic T-Shirt, Black, Small
Zazzle Reviewer Program
Perfect memorable good quality gift for any occasion. Colors turned out like expected I ordered black t-shirt with pink prints
5.0 out of 5 stars rating
5 out of 5 stars rating
By maria h.April 8, 2026Verified Purchase
Basic T-Shirt, White, Large
I love that I got to create my T-shirt. Good quality material and the image is beautiful just as I created. The only thing I wish is there would be more templates that allowed more of the image. .

Tags

T-Shirts
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementforgeylaforgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235881824069749665
Created on: 10/13/2014, 1:05 PM
Rating: G