Tap / click on image to see more RealViewsTM
Sale Price $21.17.  
Original Price $24.90 Comp. value
per specialty mug
You save 15%

Glitch: achievement harmony hound bone china mug

Qty:
Bone China
+$6.25
-$1.55

Other designs from this category

About Mugs

Sold by

Style: Bone China

Ready for your coffee, tea, soup, cider, or other tasty beverage, this fine porcelain mug complements both casual and formal table settings. It features a subtly fluted rim and an elegantly curved handle. Serves as a great housewarming gift!

  • Dimensions:
    • 10-ounces: 2.8" D x 4" H
    • Microwave and dishwasher safe
    • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
    • Strong, ceramic construction
    • Meets FDA requirements for food and beverage safety
    • Printed on demand in Reno, NV
    • Do not overfill and be careful with hot liquids that may scald
    • Keep out of reach of children when filled with hot liquid
    Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.25" high x 7.25" wide
  • About This Design

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound bone china mug

    Glitch: achievement harmony hound This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating1.2K Total Reviews
    1045 total 5-star reviews74 total 4-star reviews15 total 3-star reviews5 total 2-star reviews15 total 1-star reviews
    1,154 Reviews
    Reviews for similar products
    5 out of 5 stars rating
    By Sarah C.January 12, 2018Verified Purchase
    Jumbo Mug
    Zazzle Reviewer Program
    I love the gorgeous lettering on this and it's the perfect gift for the women in your life! The printing looked good, I like how the image was on both sides of the mug.
    5 out of 5 stars rating
    By Julene G.January 31, 2026Verified Purchase
    Jumbo Mug
    I ordered 4 items and every one of them were exactly what I ordered! I will continue to make Zazzle my #1 go to when I need gifts! 😊 they don't disappoint!
    5 out of 5 stars rating
    By Liz L.December 20, 2016Verified Purchase
    Bone China Mug
    Creator Review
    I love the size of these mugs - I was looking for something that held a decent amount, but wasn't the 'standard' coffee mug size and shape. These were a promo item/giveaway so I really wanted them to stand out a bit and be 'different' from the norm. Love them! The printing was clear and is holding up nicely with use. I'm very pleased with the way they came out and have received many compliments on the quality.

    Tags

    Mugs
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame
    All Products
    achievementharmonyhoundglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 183489589679976770
    Created on: 10/22/2014, 12:23 PM
    Rating: G