Tap / click on image to see more RealViewsTM
Sale Price $8.84.  
Original Price $10.40 Comp. value
per keychain
You save 15%

Glitch: achievement hero cubimals keychain

Qty:
Aluminum Circle
+$2.70
+$2.70
+$13.30
+$13.30

Other designs from this category

About Keychains

Sold by

Style: Metal Circle Keychain

Keep your keys safe and spectacular with this sturdy aluminum keychain from Zazzle. Beautifully printed on both sides, you can choose from thousands of designs, or personalize it with your own photos, text or unique designs. Label your car keys or keep a family photo of loved ones close to you at all times, these personalized keychains are light and waterproof.

  • Dimensions:
    • Diameter: 2"
    • Depth: 0.045"
    • Weight: 0.05 oz.
  • Full-color, full-bleed printing
  • Silver colored metal key ring with plastic snap ring
  • Light and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 2” in diameter. For best results please add 1/16" bleed

About This Design

Glitch: achievement hero cubimals keychain

Glitch: achievement hero cubimals keychain

Glitch: achievement hero cubimals This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4195 total 5-star reviews782 total 4-star reviews215 total 3-star reviews116 total 2-star reviews102 total 1-star reviews
5,410 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Aluminum Circle, 2"
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
5 out of 5 stars rating
By linda f.June 18, 2025Verified Purchase
Premium Round, Small (1.44")
So cute and this is perfect!!!
5 out of 5 stars rating
By V.August 21, 2023Verified Purchase
Zazzle Reviewer Program
Beyond expectations. Choice of artwork is overwhelming, I found exactly what I needed from SJW_Graphics. Detail, colors, overall design looks great on this keyring. Could use as a pendant, purse charm, bookmark, too! Metal is sturdy without being heavy. Colors beautiful, with clear margins. Customized name makes this gift extra special. So many fonts, so many colors & sizes!
Original product

Tags

Keychains
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementherocubimalsglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146528940696249206
Created on: 10/22/2014, 12:39 PM
Rating: G