Tap / click on image to see more RealViewsTM
Sale Price $3.33.  
Original Price $3.70 Comp. value
per button
You save 10%

Glitch: achievement homesteader button

Qty:
Round
+$2.15
+$1.20
Small, 1¼ Inch
+$1.25
+$2.05
+$3.60
+$6.85

Other designs from this category

About Buttons

Sold by

Shape: Round

With Zazzle custom buttons you can do more than just express a political opinion. Since you can add your own designs, pictures, and text you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 1.25" to 6" diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age.

About This Design

Glitch: achievement homesteader button

Glitch: achievement homesteader button

Glitch: achievement homesteader This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating8.6K Total Reviews
7652 total 5-star reviews635 total 4-star reviews134 total 3-star reviews57 total 2-star reviews72 total 1-star reviews
8,550 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Karissa D.February 28, 2022Verified Purchase
Round, Large, 3 Inch
Zazzle Reviewer Program
I love the quality and the color and the design I got to customize them to the way I like my husband and I are different and it was really nice that I could custom mama instead of mommy or mom because I like to be called mama so that was nice and then I was able to make his big sisters to buttons as well so that was really nice. I love the design it’s simple it’s cute I can’t wait to wear them on my baby shower day.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cynthia U.July 4, 2024Verified Purchase
Round, Standard, 2¼ Inch
The button was just as expected. My mother's smile was captured so beautifully. The size was just right and the colors we chose were bright. The print was nice and clear. A person ordering should just make sure the wording is lined up in the center before submitting
5.0 out of 5 stars rating
5 out of 5 stars rating
By Will G.November 16, 2021Verified Purchase
Round, Standard, 2¼ Inch
Zazzle Reviewer Program
I bought the product and I was like this is the right size. It turned out great.

Tags

Buttons
achievementhomesteaderglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementhomesteaderglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 145810679956863439
Created on: 10/22/2014, 1:24 PM
Rating: G