• Events
Tap / click on image to see more RealViewsTM
Sale Price $21.47.  
Original Price $25.25 Comp. value
per towel
You save 15%

Glitch: bubble tea towel

Qty:

    Other designs from this category

    About Kitchen Towels

    Sold by

    Style: Kitchen Towel 16" x 24"

    Brighten up any kitchen with new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram, or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

    • Dimensions: 16" x 24"
    • 80% durable woven polyester/ 20% polyamide blend microfiber
    • White-colored back-side is non-customizable
    • Machine washable
    • Imported, printed in the USA
    Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 24". For best results please add 5/7" bleed.

    About This Design

    Glitch: bubble tea towel

    Glitch: bubble tea towel

    Glitch: bubble tea This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

    Customer Reviews

    4.8 out of 5 stars rating1.2K Total Reviews
    1021 total 5-star reviews119 total 4-star reviews36 total 3-star reviews14 total 2-star reviews16 total 1-star reviews
    1,206 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Paul B.April 26, 2026 • Verified Purchase
    Kitchen Towel
    I am very happy with this tea towel. It feels warm and inviting and it instantly added a relaxed feel to my event. Colorful in my kitchen too. I will order more gifts from this store and highly recommend to you all. Thank you.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Corinne D.February 7, 2018 • Verified Purchase
    Kitchen Towel
    Creator Review
    My photos don’t do the colors of my gorgeous kitchen towel justice. It’s absolutely beautiful! The printing is gorgeous!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Barbara K.December 26, 2023 • Verified Purchase
    Kitchen Towel
    Zazzle Reviewer Program
    I bought one of these for each of my kids. Both are adults. It was great that I could personalize them with names. Rave reviews from the recipients! Nice quality print on cotton. Pleased with the results!

    Tags

    bubbleteaglitchglitchenwetdryvactinyspeckglitchthegame

    Other Info

    Product ID: 197307328647115818
    Created on: 10/3/2014, 7:30 AM
    Rating: G