Tap / click on image to see more RealViewsTM
Sale Price $33.11.  
Original Price $38.95 Comp. value
per water bottle
You save 15%

Glitch: compounds cosmox water bottle

Qty:
Heads-up!
Sorry, this Color is temporarily sold out. Please select another Color.
24 oz
Black

Other designs from this category

About Water Bottles

Sold by

Size: Water Bottle (24 oz)

Drink more water. Your skin, hair, body, and mind will thank you. And now, drink out of a fully customizable water bottle and your sense of style will thank you as well. Dang, hydration never looked so good!

  • 24 oz. bottle.
  • Made with 18/8 stainless steel.
  • Height: 10.8" Weight: 10 oz.
  • Comes with a threaded lid.
  • Lightweight and durable; crack proof, spill proof.
  • Hand wash only. Not recommended for dishwasher.
  • Does not give beverages a plastic taste.
  • Safe for refrigerator, but not freezer.
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Glitch: compounds cosmox water bottle

Glitch: compounds cosmox water bottle

Glitch: compounds cosmox This Glitch is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating603 Total Reviews
505 total 5-star reviews73 total 4-star reviews9 total 3-star reviews7 total 2-star reviews9 total 1-star reviews
603 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ethan R.January 27, 2020Verified Purchase
Water Bottle, Stainless Steel, 24 oz
Zazzle Reviewer Program
I love this water bottle. My artwork really pops on the bottle and I get compliments on it almost overtime I use it. The print job came out great. I'm very proud of it. Its a good seller in my shop:) Not the first bottle I've printed, definitely not the last. Printing came out great. Colors are slightly different in regards to hues from my original files, but the difference is minimal. Looks great!
5 out of 5 stars rating
By T.June 4, 2020Verified Purchase
Water Bottle, Stainless Steel, 24 oz
Zazzle Reviewer Program
The stainless Best Friends Avocado water bottle is perfect. Well made, and adorable! It was the best thing in her birthday gift basket! The printing of the set design and customization was better than I expected it to be! They aren’t sticker decals, it is great quality, true to color embossing. We were very pleased when this arrived.. even before it’s predicted ETA.
5 out of 5 stars rating
By Paul D.August 2, 2020Verified Purchase
Water Bottle, Black, 18 oz
Zazzle Reviewer Program
The product looks great and it's stainless also it's recommended for hydration. Plus even for workouts too. the printing looks great and also the pictures of Batman and so as the logos.

Tags

Water Bottles
compoundscosmoxglitchglitchenwetdryvactinyspeckglitchthegame
All Products
compoundscosmoxglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256729358955685456
Created on: 2/15/2015, 4:44 AM
Rating: G