Tap / click on image to see more RealViewsTM
Sale Price $33.93.  
Original Price $37.70 Comp. value
per tie
You save 10%

Glitch Cthulhu Mask Neck Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 55"
    • Width: 4" (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Glitch Cthulhu Mask Neck Tie

Glitch Cthulhu Mask Neck Tie

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1800 total 5-star reviews324 total 4-star reviews139 total 3-star reviews68 total 2-star reviews113 total 1-star reviews
2,444 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Emily L.October 30, 2019Verified Purchase
Tie
Zazzle Reviewer Program
I bought this tie for a cosplay of Haruhi Fujioka for Halloween and anime conventions. It feels very nice and silky. It's my first tie ever, and I'm a pretty big fan since I always wanted a tie. It was longer than I expected it to be (quite a plus), but the purple stripe was also thinner than I expected it to be (a slight bit of a downer, but I don't mind too much). I had never used Zazzle before, but I am very impressed with the shipping time. I was looking for places to get a tie like this so last minute since the ties like this on Amazon were incompatible with Prime. Thus, I ended up here. I paid for express shipping, expected delivery October 30-31, and it arrived in the morning on the 30th. Very impressed. I might just use Zazzle again. The print job was okay. The colors were perfect, but as you can see in the pictures, the stripe was a little off-center, and there was a kink in the stripe around where it transitions from the wide end to the thin end. It should work perfectly for my cosplay, but it was a little too carelessly print to be a very professional tie.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jim L.March 10, 2013Verified Purchase
Tie
Creator Review
The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By T.November 16, 2016Verified Purchase
Tie
Creator Review
It is a well made tie. My only issue is that it's a little shorter than I usually get, but it's still long enough. The design and colors of the hibiscus flowers was amazing. The right combination of pop and fading into the background. The colors stand out, but aren't overpowering.

Tags

Ties
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 151799404367149809
Created on: 11/23/2013, 5:27 PM
Rating: G