Tap / click on image to see more RealViewsTM
Sale Price $25.84.  
Original Price $30.40 Comp. value
per shirt
You save 15%

Glitch Cthulhu Mask T-Shirt

Qty:
Kids Basic T-Shirt
+$12.00
+$23.50
+$23.50
Black
Classic Printing: No Underbase
-$6.80
-$4.05
-$6.80
-$4.05
-$4.05
-$4.05
-$4.05
-$4.05
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Kids' Basic T-Shirt

Wait 'till you get this tee on your kiddo, it'll take his everyday style to a whole new level--especially when you customize it with your own design.

Size & Fit

  • Model is 4’5” and is wearing a medium
  • Garment is unisex sizing
  • Standard fit
  • True to size

Fabric & Care

  • 6.0 oz., pre-shrunk 100% ComfortSoft® cotton; Oxford Green is 60/40
  • Shoulder-to-shoulder taping with coverstitched collar
  • Double-needle stitched armholes and sleeves
  • Imported
  • Machine wash cold

About This Design

Glitch Cthulhu Mask T-Shirt

Glitch Cthulhu Mask T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.7 out of 5 stars rating1.9K Total Reviews
1450 total 5-star reviews275 total 4-star reviews77 total 3-star reviews28 total 2-star reviews26 total 1-star reviews
1,856 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.February 12, 2021Verified Purchase
Kids Basic T-Shirt, Navy, Youth M
Zazzle Reviewer Program
Nice tshirt and my nephew really loves it. I didn’t actually see it in person but from the picture and according to my sister we are happy with it
5 out of 5 stars rating
By Britani L.September 11, 2025Verified Purchase
Kids Basic T-Shirt, White, Youth XS
The shirt is great and everything my daughter has been wanting since we lost our Grandfather. This helps her when she is in school upset to feel close to him again! I will be ordering shirts from here for my other 4 children!
5 out of 5 stars rating
By Stephannie C.May 14, 2020Verified Purchase
Kids Basic T-Shirt, White, Youth M
Zazzle Reviewer Program
I ordered this for my 2 year old Granddaughter. It is a little big , but she will quickly grow into it. T-shirt is very good quality. Colors were vibrant...Quality printing !

Tags

T-Shirts
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 235052121719704683
Created on: 11/23/2013, 5:27 PM
Rating: G