Tap / click on image to see more RealViewsTM
Sale Price $1.87.  
Original Price $2.20 Comp. value
per postcard
You save 15%

Glitch dustbunny cubimal postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.20

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalization tool.

  • Dimensions: 5.6" L x 4.25" H; qualified USPS postcard size
  • High quality, full-color, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Glitch dustbunny cubimal postcard

Glitch dustbunny cubimal postcard

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating15.7K Total Reviews
14291 total 5-star reviews1001 total 4-star reviews201 total 3-star reviews72 total 2-star reviews118 total 1-star reviews
15,683 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ray A.September 30, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Very pleased with my order. All my prints were manufactured to a very high standard to my exact specifications and edited additions.
5 out of 5 stars rating
By Paul I.February 4, 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Creator Review
I had never seen these classic science fiction images and most of my friends have not seen them either. They are like little treasures! Amazing quality and fun to send people!
5 out of 5 stars rating
By Jennifer W.November 28, 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I joined Postcrossing a few months ago and wanted postcards to represent my state well. I found them on Zazzle. I purchased numerous cards and was impressed with all of them. Excellent! The colors are beautiful. The cards have the exact look I wanted. I couldn't be happier.

Tags

Postcards
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchendustbunnydustbunnycubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 239446639547759723
Created on: 11/23/2013, 5:38 PM
Rating: G