Tap / click on image to see more RealViewsTM
Sale Price $23.42.  
Original Price $27.55 Comp. value
per shirt
You save 15%

Glitch emo bear cubimal T-Shirt

Qty:
Womens Basic T-Shirt
+$10.80
+$26.80
+$11.75
Black
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft - a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5’7” and is wearing a small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch emo bear cubimal T-Shirt

Glitch emo bear cubimal T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating14.8K Total Reviews
10500 total 5-star reviews2858 total 4-star reviews826 total 3-star reviews379 total 2-star reviews243 total 1-star reviews
14,806 Reviews
Reviews for similar products
5 out of 5 stars rating
By eunice y.October 21, 2021Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
This Product Included Many Of My Immediate Family Members & We All Love The Excellent Quality Work Put Into Our T-Shirts & The Pricing!!! As Always Zazzle Does Excellent Quality Work On Everything We Have Ever Ordered Including Our Past Orders Our Beautiful Blankets!!
5 out of 5 stars rating
By Yuliya U.May 10, 2022Verified Purchase
Womens Basic T-Shirt, Black, Adult S
Zazzle Reviewer Program
Perfect memorable good quality gift for any occasion. Colors turned out like expected I ordered black t-shirt with pink prints
5 out of 5 stars rating
By Lisa K.September 28, 2022Verified Purchase
Womens Basic T-Shirt, White, Adult S
Creator Review
I bought each of my kids a t-shirt and they did not disappoint. I would probably buy them the black shirt next time or a better quality as my daughter loves her and has almost worn it out already. Printing is great. Could be a little darker but its cool.

Tags

T-Shirts
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235217361453915941
Created on: 11/23/2013, 5:39 PM
Rating: G