Glitch gnome cubimal (Front)Glitch gnome cubimal (Inside (Left))Glitch gnome cubimal (Inside (Right))
Glitch gnome cubimal (Back)
Sale Price $4.51.  
Original Price $5.30 Comp. value
per card
You save 15%

Glitch gnome cubimal

4.9 out of 5 stars rating
7329 Total Reviews
| by GlitchenIn
View Product Details

Popular from this Department

About Cards

Sold by

Size: Standard (5" x 7")

Birthdays or holidays, good days or hard days, Zazzle’s customized greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 5" x 7" (portrait) or 7" x 5" (landscape)
  • Full color CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 3" x 4" (portrait) or 4" x 3" (landscape)
  • Standard white envelopes included

Paper Type: Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Glitch gnome cubimal

Glitch gnome cubimal

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating7.3K Total Reviews
6714 total 5-star reviews485 total 4-star reviews70 total 3-star reviews27 total 2-star reviews33 total 1-star reviews
7,329 Reviews
Reviews for similar products
5 out of 5 stars rating
By K N.November 10, 2018Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
What strikes me most about this card on opening the envelope is the stunning color and the beautiful close up. The card itself lends it to a feel good touch as well so its a lot of senses perked! My customers like it as well! The color is stunning! The closeup is very nicely detailed and just perfectly awesome! Could not ask for better printing!
5 out of 5 stars rating
By NavinJOSHI s.August 13, 2013Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
Unusual color scheme is clearly visible on the art. Not many artist try to emphasize that as an artist they can see things different so long they look beautiful. This is an UNIQUE image. I bought a bunch of 34 different cards as like to give a different card to each of my friend which makes it very personal. When friends talk with each other, they appreciate the gesture all the more. Also I took advantage of volume pricing. Thanks to Zazzle for allowing to order even one card. I recommend people to buy from Zazzle. Pure Joy. Excellent printing and color tones.
5 out of 5 stars rating
By K N.November 10, 2018Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
iI am overjoyed and tickled pin with this card!! he minute I oened the envelope and saw it it just raised my spirits! Love the feel of the paper, its high quality all the way! And my customer really appreciaed it!! And topping that paired up with the labels was a perfect match! The color and the entire card and design is perfect! Better than I hoped and so awesome! My customer appreciiated it too! And the labels matched in color perfecty too!

Tags

Cards
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchengardengnomecubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137647836133156796
Created on: 11/23/2013, 5:41 PM
Rating: G