Tap / click on image to see more RealViewsTM
Sale Price $28.01.  
Original Price $32.95 Comp. value
per apron
You save 15%

Glitch Lem Mask Adult Apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customize it and unleash your creativity!

  • Dimensions: 24"l x 28"w
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch Lem Mask Adult Apron

Glitch Lem Mask Adult Apron

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background color by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating2.3K Total Reviews
1927 total 5-star reviews302 total 4-star reviews39 total 3-star reviews14 total 2-star reviews11 total 1-star reviews
2,293 Reviews
Reviews for similar products
5 out of 5 stars rating
By AMANDA K.October 4, 2020Verified Purchase
Apron, Standard
Zazzle Reviewer Program
This apron came out perfect. It’s exactly what I wanted! I highly recommend! Printing was clear and the colors were excellent.
5 out of 5 stars rating
By Gravityx9 D.December 14, 2018Verified Purchase
Apron, Kids
Creator Review
The apron is of very good quality. I used it while icing cookies. The dark colored icing washed off of the apron very well! The neck strap is sturdy and easy to resize on the adult size apron. The print was clear and well defined. I am glad I was able to personalize with name.
5 out of 5 stars rating
By Debbie L.March 29, 2023Verified Purchase
Apron, Standard
Zazzle Reviewer Program
These aprons are so cute and the quality of the fabric is really nice. The printing is great. Arrived super fast and they were just perfect for our Bloody Mary night on our girls’ trip. So fun!!!

Tags

Aprons
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame
All Products
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154897660550990101
Created on: 11/23/2013, 5:29 PM
Rating: G 
Related Searches
apronsapron customised