Tap / click on image to see more RealViewsTM
Sale Price $40.85.  
Original Price $48.05 Comp. value
per clock
You save 15%

Glitch: limited edition imitation grichmas yeti round clock

Qty:
8" Round Acrylic
+$6.25
+$6.25
+$0.20
+$0.20
+$0.20

Other designs from this category

About Wall Clocks

Sold by

Style: 8" Round Acrylic Wall Clock

Customize your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favorite photo, or give as a personalized gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 8" diameter or 10.75" diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2824 total 5-star reviews384 total 4-star reviews76 total 3-star reviews42 total 2-star reviews63 total 1-star reviews
3,389 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousMarch 11, 2025Verified Purchase
Wall Clock, 8" Round Acrylic
Love the clock it's exactly as pictured. I love that it's made in America. So far it keeps perfect time and is quiet.
5 out of 5 stars rating
By Patricia S.December 11, 2025Verified Purchase
Wall Clock, 8" Round Acrylic
Very pleased with purchase. Very happy it was available. One of my favorites. It more than a clock, it's a photo. Fast and secure shipping. Thank you.
5 out of 5 stars rating
By Penny K.April 24, 2023Verified Purchase
Wall Clock, 8" Round Acrylic
Zazzle Reviewer Program
The clock works perfectly. I am so happy to have found this clock on Zazzle. I grew up in Fond du Lac, WI so this lighthouse has great meaning to me. I have searched for something like this for years and couldn't even find pictures in town like this. So thank you for the pleasant surprise. The colors are so vibrant and beautiful. It truly looks like I could be looking out the window at this view it is so natural. I love everything about this clock.

Tags

Wall Clocks
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame
All Products
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256753996524584946
Created on: 10/3/2014, 7:10 AM
Rating: G