Tap / click on image to see more RealViewsTM
Sale Price $4.30.  
Original Price $5.05 Comp. value
per magnet
You save 15%

God Speed Edmund Leighton Fine Art Medieval Magnet

Qty:
Rectangle Magnet
-$1.40
-$0.80
2.5" x 3.5"

Other designs from this category

About Magnets

Sold by

Shape: Rectangle Magnet

Your refrigerator called and said it was feeling mighty lonely. Why not give it a few friends to play with by creating a couple of custom magnets! Add your favorite image to a round magnet, or shop the thousands of options for a cool square magnet.

  • Available in 3.5" x 2.5" or 2.5" x 3.5"
  • USA Made with recycled domestic steel
  • Smooth glossy mylar finish
  • Printed on FSC Certified recycled paper stock

About This Design

God Speed Edmund Leighton Fine Art Medieval Magnet

God Speed Edmund Leighton Fine Art Medieval Magnet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating6.9K Total Reviews
6130 total 5-star reviews567 total 4-star reviews118 total 3-star reviews46 total 2-star reviews39 total 1-star reviews
6,900 Reviews
Reviews for similar products
5 out of 5 stars rating
By Delores C.August 13, 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 3.5" x 2.5"
Creator Review
The magnet is sturdy and bright and the print quality is great! .
5 out of 5 stars rating
By AnonymousFebruary 9, 2026Verified Purchase
Magnet, Style: Square, Size: 2 Inch
Loved the magnet, quality is amazing.
5 out of 5 stars rating
By Joanne A.November 7, 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 3.5" x 2.5"
Given as gifts everyone appreciative .

Tags

Magnets
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256868322552475579
Created on: 8/1/2023, 7:12 AM
Rating: G