Tap / click on image to see more RealViewsTM
Sale Price $25.76.  
Original Price $30.30 Comp. value
per planner
You save 15%

God Speed Edmund Leighton Fine Art Medieval Planner

Qty:
Black

Other designs from this category

About Planners

Sold by

Size: Standard (8.5" x 11")

If it’s not in your planner, it’s not happening, right? Well, no matter what the week, month, or year throws at you, you can handle it with your trusty, customized Softplanner from Zazzle! Add your own pictures, artwork, or personal motto to the cover and get ready to take on the world, one carefully planned day at a time!

  • Dimensions: 8.5″ x 11″
  • Includes monthly overview and weekly planning space
  • 60 pages and 12 months long
  • Made from 60lb text-smooth paper
  • Cover Thickness (Softcover):12pt cover stock laminated with 5 mil gloss lamination
  • Cover Thickness (Hardcover): Label stock laminated with a 1.5mil satin-matte lamination and adhered and wrapped around a 70lb chipboard
  • Bound with 0.5″ metal Wire-o® spiral spine
Consumer Product Safety Improvement Act compliant. Tracking label inside back cover

About This Design

God Speed Edmund Leighton Fine Art Medieval Planner

God Speed Edmund Leighton Fine Art Medieval Planner

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.7 out of 5 stars rating287 Total Reviews
246 total 5-star reviews24 total 4-star reviews3 total 3-star reviews3 total 2-star reviews11 total 1-star reviews
287 Reviews
Reviews for similar products
5 out of 5 stars rating
By Andreja K.July 24, 2021Verified Purchase
Small (5.5" x 8.5"), Soft Cover, White Spiral Planner
Zazzle Reviewer Program
The hardcovers are super sturdy, they came undamaged, the print on the front was as expected. The interior of the notebook is good for planning monthly and weekly. The notes section is a bit small for my taste, but I can manage. I like the idea that months are only numbered at the beginning and not afterward, you get to write the numbers of the days and weeks as you wish. The printing turned out as expected, not too big of a difference from the colors seen on screen.
5 out of 5 stars rating
By Teresa P.August 19, 2025Verified Purchase
Standard (8.5" x 11"), Hard Cover, Black Spiral Planner
Creator Review
I Love my Zazzle Planner. Love the hard cover which makes writing in the planner so much easier., The daily planner pages are perfect for keeping track of daily events. The image colors and design are vibrant and awesome. Thank You for such a GREAT Planner.
5 out of 5 stars rating
By Heather H.June 3, 2020Verified Purchase
Small (5.5" x 8.5"), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
Fantastic quality. love seeing my family looking back at me as I plan the year. I will actually be using it for homeschool planning too. Will work great for me! Color is superb! Excellent job

Tags

Planners
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256869878912485903
Created on: 1/13/2024, 12:00 AM
Rating: G 
Related Searches
plannerscustom planner