Tap / click on image to see more RealViewsTM
Sale Price $7.78.  
Original Price $9.15 Comp. value
per set of 3 sheets
You save 15%

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheets

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 19" x 29"

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customizable! Mix and match designs to create unique combinations
  • Dimensions: (3) 19.5" x 28.5" sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheets

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheets

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating1K Total Reviews
949 total 5-star reviews46 total 4-star reviews13 total 3-star reviews4 total 2-star reviews20 total 1-star reviews
1,032 Reviews
Reviews for similar products
5 out of 5 stars rating
By C L.November 8, 2021Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
Zazzle Reviewer Program
This is a great heavy weight paper. No peeking through with this paper. Grid lines on the back for clumsy cutters like me. Designs are pretty but larger than I expected. Printing quality is great. As is the blue color…..I just love it!!
5 out of 5 stars rating
By Victoria B.December 27, 2020Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
Creator Review
I am extremely satisfied with my product. Everyone that received a gift wrapped with these design loved the customized wrapping paper. The printing turned out well.
5 out of 5 stars rating
By jasmine p.January 10, 2026Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte 19" x 29"
I absolutely loved this wrapping paper! The material was thick but still smooth, which made it easy to wrap and feel very high quality. The picture I uploaded came out perfect and looked so cute — the print quality exceeded my expectations. It arrived just in time for Christmas, and my whole family loved it. I will definitely be ordering again. Such a fun and special touch for gifts!

Tags

Wrapping Paper Sheet Sets
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256420946038786223
Created on: 8/4/2023, 1:18 AM
Rating: G