Tap / click on image to see more RealViewsTM
Sale Price $8.52.  
Original Price $10.65 Comp. value
per sticker
You save 20%

Golden Retriever Air Force Daddy Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 8" L x 8.5" H
  • Design Area: 8" L x 8" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Golden Retriever Air Force Daddy Sticker

Golden Retriever Air Force Daddy Sticker

This Golden Retriever Air Force Daddy Sticker is a great way to show off your love for your dog and for your service in the US Air Force in your everyday routine.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
880 total 5-star reviews63 total 4-star reviews27 total 3-star reviews27 total 2-star reviews74 total 1-star reviews
1,071 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
3 out of 5 stars rating
By Ella K.June 5, 2025Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
The design came in perfect! Very happy with that but every sticker started ripping at the edges because they were not cut around properly to peel .

Tags

Custom-Cut Vinyl Stickers
golden retrieverair forcedaddystickermilitaryfamilypetlovedogsdog lover
All Products
golden retrieverair forcedaddystickermilitaryfamilypetlovedogsdog lover

Other Info

Product ID: 256740803591964085
Created on: 11/3/2023, 6:11 PM
Rating: G