Tap / click on image to see more RealViewsTM
Sale Price $9.06.  
Original Price $10.65 Comp. value
per sticker
You save 15%

Golden Retriever Air Force Daddy Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 8" x 8" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 8" L x 8.5" W
  • Design Area: 8" L x 8" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Golden Retriever Air Force Daddy Sticker

Golden Retriever Air Force Daddy Sticker

This Golden Retriever Air Force Daddy Sticker is a great way to show off your love for your dog and for your service in the US Air Force in your everyday routine.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
893 total 5-star reviews64 total 4-star reviews27 total 3-star reviews27 total 2-star reviews79 total 1-star reviews
1,090 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
Extra-Large 14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
5 out of 5 stars rating
By Jenn K.August 20, 2019Verified Purchase
Medium 6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.

Tags

Custom-Cut Vinyl Stickers
golden retrieverair forcedaddystickermilitaryfamilypetlovedogsdog lover
All Products
golden retrieverair forcedaddystickermilitaryfamilypetlovedogsdog lover

Other Info

Product ID: 256740803591964085
Created on: 11/3/2023, 6:11 PM
Rating: G 
Related Searches
stickerstickers custom