Tap / click on image to see more RealViewsTM
Sale Price $29.97.  
Original Price $35.25 Comp. value
per binder
You save 15%

Grandma's Recipe Cookbook Purple Floral Greenery 3 Ring Binder

Qty:
1" Paper Capacity
+$3.15

Other designs from this category

About Binders

Sold by

Size: Avery Signature 1" Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 10"w x 11.75"l; Spine: 1.4"
  • 3-ring binder designed for letter (8.5" x 11") sized paper
  • 1" capacity, fits 275 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

1" Capacity: 275 pages
1.5" Capacity: 400 pages
2" Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Grandma's Recipe Cookbook Purple Floral Greenery 3 Ring Binder

Grandma's Recipe Cookbook Purple Floral Greenery 3 Ring Binder

Customized "Grandma's secret holiday recipes" binder keepsake cookbook with beautiful purple watercolor flowers and greenery. This is a perfect cookbook to collect grandma's favorite recipes put them into one collection. This would make a beautiful gift from a grandmother to her daughters or granddaughters. Recipes written in her own handwriting to pass down for generations to come will be a special gift that they will not soon forget.

Customer Reviews

4.8 out of 5 stars rating1.6K Total Reviews
1355 total 5-star reviews151 total 4-star reviews34 total 3-star reviews26 total 2-star reviews24 total 1-star reviews
1,590 Reviews
5 out of 5 stars rating
By JoAnne V.April 26, 2023Verified Purchase
Avery Signature Binder, 1" Paper Capacity
Zazzle Reviewer Program
This 2 ring binder is just perfect for what I was searching for as a unique shower gift for my grand niece. The guests for her bridal shower have been requested to submit a favorite family recipe. I am typing each one in a uniform way that is easy to read and follow. I have recipes from the future brides grandmothers and aunts that are difficult to replace. The binder is lovely and I ordered a matching apron with the same flower motif,. Hopefully, it will be a treasured family keepsake. The design is perfect and just what I selected.
Reviews for similar products
5 out of 5 stars rating
By Barbara S.September 16, 2021Verified Purchase
Avery Signature Binder, 1.5" Paper Capacity
Zazzle Reviewer Program
It was fun to personalize it! Can be for any occasion! The watercolor design is so colorful & perfect for my tropical Florida cookbook. Thank you for the beautiful product & ultra fast shipping.....thinking Christmas gifts now! Beautiful, vibrant colors.
5 out of 5 stars rating
By AnonymousJanuary 3, 2026Verified Purchase
Avery Signature Binder, 1.5" Paper Capacity
I ordered three customized binders to preserve my parents’ treasured recipes, and I couldn’t be happier with how they turned out. The binders arrived within a week, which was a wonderful surprise. The quality is really good. It is sturdy, well-made, and exactly what I was hoping for. I loved that I was able to customize them exactly the way I wanted, and the spine comfortably fit our eight-letter last name, which made the personalization feel complete and special. My parents passed away within months of each other in 2025, and I now have their red recipe box filled with so many meaningful family recipes. I wanted to share these with my siblings, so I copied all the recipes in color and placed them in sheet protectors inside the binders. They look absolutely wonderful, organized, vibrant, and truly special. These binders turned a box of memories into a beautiful keepsake, and I can’t wait to give them to my siblings. I’m so grateful to Zazzle for helping me create something that honors my parents and keeps our family traditions alive. Highly recommend!

Tags

Binders
grandmas secret holiday recipescookbookpurple watercolor floralflowersgreeneryspringtimekeepsakegifts for the kitchengifts for the cook
All Products
grandmas secret holiday recipescookbookpurple watercolor floralflowersgreeneryspringtimekeepsakegifts for the kitchengifts for the cook

Other Info

Product ID: 127581045843596519
Created on: 4/19/2021, 8:28 AM
Rating: G 
Related Searches
recipe booksrecipe books