Tap / click on image to see more RealViewsTM
Sale Price $2.68.  
Original Price $3.15 Comp. value
per sticker
You save 15%

Great Seal of the Republic of the Philippines Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 3" x 3" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 3" L x 3.5" W
  • Design Area: 3" L x 3" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Great Seal of the Republic of the Philippines Sticker

Great Seal of the Republic of the Philippines Sticker

The Philippines is an emerging market and a developing and newly industrialized country, whose economy is transitioning from being agricultural to service- and manufacturing-centered.

Customer Reviews

4.4 out of 5 stars rating107 Total Reviews
84 total 5-star reviews8 total 4-star reviews2 total 3-star reviews5 total 2-star reviews8 total 1-star reviews
107 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sheila J.June 5, 2022Verified Purchase
Large 8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
All the kiss-cut stickers we've ordered have been perfect -- great quality stickers and always well cut. The colors on these watercolor heart stickers really pop and are very pretty! We're using them as envelope seals on cellulose packages.
5 out of 5 stars rating
By AnonymousAugust 7, 2025Verified Purchase
This design is delightful! As pretty in person as on the site. I thought it looked best applied with a white background behind it! Would recommend!!!
5 out of 5 stars rating
By Susan K.July 5, 2024Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
This label did not contain any errors as the large one did. Again, this label did not contain any errors of the large one did

Tags

Custom-Cut Vinyl Stickers
philippinesflagtravelpilipinasmanilastickersfilipinoquezon citycoat of armscountry seals
All Products
philippinesflagtravelpilipinasmanilastickersfilipinoquezon citycoat of armscountry seals

Other Info

Product ID: 256996505248596382
Created on: 6/24/2025, 11:54 AM
Rating: G