Tap / click on image to see more RealViewsTM
Sale Price $7.64.  
Original Price $9.54 Comp. value
each
You save 20%

Green Watercolor Table Tent Sign

Qty:

Other designs from this category

About Table Tent Signs

Sold by

Size: Table Tent Sign 4" X 6"

Customize your business or special events with our table tent signs! Personalization is available on one, both sides, or full wrap to ensure your message is clear and concise.

  • Available in 2 sizes
  • Made with high quality cardstock
  • Digital Full Color Print and Heat Bend
  • Two Prints Areas: Front of table tent and back - or a fully wrapped consistent design

Media: Polystyrene

Professional, durable, and beautiful—our plastic signs will showcase your design and make a lasting impression.

About This Design

Green Watercolor Table Tent Sign

Green Watercolor Table Tent Sign

Elevate the look of your wedding or event tables with our beautiful green watercolor table number tent signs. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The tent signs are double-sided, allowing your guests to easily read the table number from any angle. The numbers are fully customizable, allowing you to choose the number and layout to fit your specific theme and event. These table number signs are printed on high-quality cardstock and come folded with a stand to make it easy to display. Impress your guests with our stunning green watercolor table number tent signs at your special event.

Customer Reviews

5.0 out of 5 stars rating7 Total Reviews
7 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
7 Reviews
Reviews for similar products
5 out of 5 stars rating
By Teresa P.April 25, 2025Verified Purchase
Table Tent Sign, Size: 4" X 6", Media: Polystyrene
These table number tents are perfect for my daughter's wedding! .
5 out of 5 stars rating
By Stephanie O.December 4, 2023Verified Purchase
Table Tent Sign, Size: 4" X 6", Media: Polystyrene
Zazzle Reviewer Program
Arrived quicker than expected. Durable quality that seems like it will hold up well for my event venue who will use and re-use these many times. No scratching to date, easy to store and stack. Printing looked exactly as expected and hoped for. Loved the font options
5 out of 5 stars rating
By Debbie C.September 28, 2022Verified Purchase
Zazzle Reviewer Program
Good quality, pretty design. Quality printing, clear and precise

Tags

Table Tent Signs
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256509667133572082
Created on: 1/27/2023, 7:20 AM
Rating: G