Tap / click on image to see more RealViewsTM
Sale Price $5.92.  
Original Price $7.40 Comp. value
per set of 6 labels
You save 20% ends today

Green Watercolor Wedding Table Number Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-$1.25
-$2.50
+$4.95
+$4.95
+$4.95
+$4.95
+$4.95

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customize a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties, and birthday parties.

  • Dimensions: 3.5" x 4"; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-color, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.5" x 4". For best results please add 0.13" bleed.

About This Design

Green Watercolor Wedding Table Number Wine Label

Green Watercolor Wedding Table Number Wine Label

Make a statement at your wedding or event tables with our beautiful green watercolor table number wine labels. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The labels are fully customizable. These table number labels are perfect to put on wine bottles, or any other beverage, as a way to indicate table numbers. These table number labels are printed on high-quality, waterproof and adhesive material, making it easy to stick and display on your bottles. Impress your guests with our stunning green watercolor table number wine labels at your special event.

Customer Reviews

4.9 out of 5 stars rating585 Total Reviews
540 total 5-star reviews27 total 4-star reviews4 total 3-star reviews5 total 2-star reviews9 total 1-star reviews
585 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.June 11, 2020Verified Purchase
Sparkling Wine Bottle Labels (4" x 3.5")
Zazzle Reviewer Program
I bought these labels just to add a personal touch to the wine bottles on my wine rack. The color of the labels blend with my color scheme better than the original labels. If you are into monograms, there nothing like your initial or last name on a wine bottle. The print turned out beautifully just as it was in the photo. I only wish I had added a border to the labels just to bring them out a little more.
5 out of 5 stars rating
By c.October 7, 2018Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
We make wine every year and work very hard to better our product each year. We learned long ago that nice packaging makes our home vintage much more impressive for ourselves and those we gift with a bottle or two. This year we used a cactus theme and the labels customized beautifully. Just wish they were more reasonable price wise. Looked Great! Very Professional
5 out of 5 stars rating
By Kelly g.September 13, 2023Verified Purchase
Sparkling Wine Bottle Labels (4" x 3.5")
Zazzle Reviewer Program
I would recommend this product to anyone that wants to create custom wine labels. The quality is great and comes back to you just how you created it. The quality of printing is top notch.

Tags

Food and Beverage Label Sets
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256730755502215084
Created on: 1/27/2023, 7:57 AM
Rating: G