Tap / click on image to see more RealViewsTM
Sale Price $2.28.  
Original Price $2.85 Comp. value
per button
You save 20%

Green Woman - Wood Button

Qty:
Round Button
+$1.70
+$0.95
Small, 1¼ Inch

Other designs from this category

About Buttons

Sold by

Shape: Round Button

With Zazzle custom buttons you can do more than just express a political opinion. Since you can add your own designs, pictures, and text you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 1.25" to 6" diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age.

About This Design

Green Woman - Wood Button

Green Woman - Wood Button

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the center of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating8.4K Total Reviews
7532 total 5-star reviews625 total 4-star reviews131 total 3-star reviews54 total 2-star reviews63 total 1-star reviews
8,405 Reviews
Reviews for similar products
5 out of 5 stars rating
By Karissa D.February 28, 2022Verified Purchase
Round Button, Large, 3 Inch
Zazzle Reviewer Program
I love the quality and the color and the design I got to customize them to the way I like my husband and I are different and it was really nice that I could custom mama instead of mommy or mom because I like to be called mama so that was nice and then I was able to make his big sisters to buttons as well so that was really nice. I love the design it’s simple it’s cute I can’t wait to wear them on my baby shower day.
5 out of 5 stars rating
By Will G.November 16, 2021Verified Purchase
Round Button, Standard, 2¼ Inch
Zazzle Reviewer Program
I bought the product and I was like this is the right size. It turned out great.
5 out of 5 stars rating
By Udeepa G.July 8, 2024Verified Purchase
Round Button, Standard, 2¼ Inch
Beautiful concept I like the design and words and colors and all. looking forward to buy more products. Better that what I expected. Paint is high in detail and durable.

Tags

Buttons
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256305253868111648
Created on: 4/23/2025, 9:56 AM
Rating: G