Tap / click on image to see more RealViewsTM
Sale Price $9.68.  
Original Price $12.10 Comp. value
per coaster
You save 20%

Green Woman - Wood Coaster

Qty:

Other designs from this category

About Coasters

Sold by

Style: Sandstone Drink Coaster

Mom always told you to use a coaster, so make her happy by using one from Zazzle! Made to keep your tables scratch-and-moisture-free, our sandstone coasters have a cork backing, so you can use them on any surface. They also have a matte finish and work best with vintage illustrations, black-and-white photos, and personal text messages.

  • Dimensions:
    • Diameter: 4.25"
    • Thickness: 0.25"
    • Weight: 3.88 oz.
  • Made of sandstone with a cork pad backing
  • Not dishwasher safe
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4.25" x 4.25". For best results please add 1/8" bleed

About This Design

Green Woman - Wood Coaster

Green Woman - Wood Coaster

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the center of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.6 out of 5 stars rating492 Total Reviews
384 total 5-star reviews69 total 4-star reviews20 total 3-star reviews7 total 2-star reviews12 total 1-star reviews
492 Reviews
Reviews for similar products
5 out of 5 stars rating
By B.November 3, 2012Verified Purchase
Sandstone Coaster
Zazzle Reviewer Program
surprisingly good quality......not just a casual gift. sharp and appropriate
5 out of 5 stars rating
By K.May 13, 2024Verified Purchase
Beautiful horse drawing on this coaster makes it a great conversation piece. Artist is very talented! The printing Zazzle did is nice and crisp, but not as black as I would have liked and the edges had some execess on them But some sandpaper fixed the issue
Original product
5 out of 5 stars rating
By Michael T.September 2, 2016Verified Purchase
Sandstone Coaster
Creator Review
Pleased with the overall quality of this type of coaster. I bought a set of these and each one was packaged carefully in bubble wrap to protect from breakage. The coasters are very classy looking and fun to use. I would recommend to anyone. Printing is less bright than on other products such as say, magnets or mugs, but that's to be expected given that they are printed on sandstone. Somewhat dull, but true to how the product is represented on the Zazzle website. I am pleased with the quality and would order again. Would make a great gift.

Tags

Coasters
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256817263225016912
Created on: 4/23/2025, 10:57 AM
Rating: G