Tap / click on image to see more RealViewsTM
Sale Price $21.47.  
Original Price $25.25 Comp. value
per keychain
You save 15%

Green Woman - Wood Keychain

Qty:
Premium Round
-$16.55
-$18.30
-$16.55
Small (1.44")

Other designs from this category

About Keychains

Sold by

Style: Premium Round Keychain

Keep your keys safe and spectacular with a round keychain from Zazzle. You can customize it with designs, photographs, or text. These keychains are waterproof and have a UV coating that will protect any image or design you add.

  • Dimensions:
    • Diameter: 1.44"
    • Depth: 0.19"
    • Weight: 0.705 oz.
  • Full-color, full-bleed printing
  • Silver colored metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 1.16" x 1.16". For best results please add 1/16" bleed

About This Design

Green Woman - Wood Keychain

Green Woman - Wood Keychain

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the center of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4185 total 5-star reviews779 total 4-star reviews212 total 3-star reviews115 total 2-star reviews96 total 1-star reviews
5,387 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kenton W.September 15, 2024Verified Purchase
Aluminum Circle, 2"
I Had To Buy Another One Of These Because The One Im Holding Was Not Red I Order Another One Please Make Sure It’s Red Like The Photo Described The 2nd Photo Is The One I Just Order.
5 out of 5 stars rating
By Mary K.May 2, 2023Verified Purchase
Premium Round, Large (2.125")
Zazzle Reviewer Program
Really nice quality keychain and the size is isrgect! I love the Artist Pika design on this keychain!!! Printing of the design is chest and color is great! Just looking at this design makes me smile! Love my new Artist Pika keychain!
5 out of 5 stars rating
By Lori A.February 3, 2021Verified Purchase
Aluminum Circle, 2"
Zazzle Reviewer Program
I upgraded and was happy I did because I love it. It exceeded my expectations. I have TSD so means something to me. Plus the artist that designed it is amazing. she has many products and many designs. I got RSD you could get MS fibro lyme disease etc. You choose the condition she has many to pick from. Printing was 100% accurate and looks like it's a great wuality

Tags

Keychains
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256756199699760004
Created on: 4/23/2025, 10:01 AM
Rating: G