Tap / click on image to see more RealViewsTM
Sale Price $35.92.  
Original Price $42.25 Comp. value
per clock
You save 15%

Green Woman - Wood Large Clock

Qty:
10.75" Round Acrylic
-$4.85
-$4.70
-$4.70
-$4.70

Other designs from this category

About Wall Clocks

Sold by

Style: 10.75" Round Acrylic Wall Clock

Customize your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favorite photo, or give as a personalized gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 8" diameter or 10.75" diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Green Woman - Wood Large Clock

Green Woman - Wood Large Clock

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the center of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.7 out of 5 stars rating3.4K Total Reviews
2821 total 5-star reviews384 total 4-star reviews76 total 3-star reviews42 total 2-star reviews62 total 1-star reviews
3,385 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joanna C.November 4, 2020Verified Purchase
Wall Clock, 10.75" Square Acrylic
Zazzle Reviewer Program
It arrived on time and in good condition and it works. Zazzle has been great to work with. I have no complaints at all. I loved that the product turned out as expected!
5 out of 5 stars rating
By Virginia W.July 23, 2020Verified Purchase
Wall Clock, 10.75" Round Acrylic
Zazzle Reviewer Program
Great price for a very nice product. Arrived a day early - unheard of these days. The outside gold area has a little more orange tone to it than shown in the picture. Great packing so product can't get damaged. I used the same packing to forward the clock to my brother and sister-on-law for the 50th wedding anniversary. Printing was just as expected - lovely!
4 out of 5 stars rating
By Teofla R.January 3, 2023Verified Purchase
Wall Clock, 8" Round Acrylic
Zazzle Reviewer Program
My 93- yr. old Dad has everything.....and now including a clock with pictures of him in action! Was initially a bit difficult to size & position the pictures in each space, but the end product was worth the effort. He enjoyed it and it was definitely a unique way of memorializing good times in his life. Quality of print was good.

Tags

Wall Clocks
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256686808927638609
Created on: 4/23/2025, 10:32 AM
Rating: G