Tap / click on image to see more RealViewsTM
Sale Price $2.92.  
Original Price $3.65 Comp. value
per magnet
You save 20% ends today

Green Woman - Wood Magnet

Qty:
Circle
+$1.40
+$0.60
Small, 1¼ Inch

Other designs from this category

About Magnets

Sold by

Shape: Circle

Your refrigerator called and said it was feeling mighty lonely. Why not give it a few friends to play with by creating a couple of custom magnets! Add your favorite image to a round magnet, or shop the thousands of options for a cool square magnet.

  • Available in 3 sizes from 1.25" to 3" diameter
  • Printed on 100% recycled paper
  • Covered with scratch and UV-resistant mylar
  • Available in square shape also

About This Design

Green Woman - Wood Magnet

Green Woman - Wood Magnet

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the center of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating6.8K Total Reviews
6083 total 5-star reviews565 total 4-star reviews117 total 3-star reviews43 total 2-star reviews36 total 1-star reviews
6,844 Reviews
Reviews for similar products
5 out of 5 stars rating
By Faye R.February 2, 2021Verified Purchase
Magnet, Style: Circle, Size: Standard, 2¼ Inch
Creator Review
The heart magnet is for everyone-valentines day -birthdays. Every day any holiday -use fo pin teacher notes or kid photos or even your pet photos. Was great unique design with a great print buy many. Resell at yur own business or give for rewards. Excellent print on a great magnet. I would definitely buy this again.
5 out of 5 stars rating
By Mary S.February 11, 2020Verified Purchase
Magnet, Style: Circle, Size: Standard, 2¼ Inch
Zazzle Reviewer Program
Amazing we could get such a cool CUSTOMIZED softball magnet for such an affordable price...like $3.50 I think?! Of course my granddaughter loved it with her own initials printed on her favorite sports ball! Perfect, exactly as it looks online.
5 out of 5 stars rating
By Michael T.September 2, 2016Verified Purchase
Magnet, Style: Circle, Size: Large, 3 Inch
Creator Review
The magnets are very well made and the magnet on the back of the design takes up most of the surface area which results in a strong bond with your fridge. If you are using this to hold up papers, shopping lists, etc, it does an excellent job. I was very pleased with how this turned out. The lines are sharp, the design is clear and a clear protective coating or cover keeps the design well protected so if needed it can be wiped clean without damaging the design. I would highly recommend.

Tags

Magnets
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256096699561023212
Created on: 4/23/2025, 10:04 AM
Rating: G