Tap / click on image to see more RealViewsTM
Sale Price $20.57.  
Original Price $24.20 Comp. value
per shirt
You save 15%

Guardian Ancestor Hypatia, Men's T-Shirt

Qty:
Value T-Shirt
+$1.50
+$1.50
+$12.20
Black
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Men's Value T-Shirt

This classic silhouette is an affordable alternative heavyweight t-shirt for the value-conscious consumer. Rest assured as this t-shirt is pre-shrunk and made from 100% cotton. It also has double-needle stitched bottom and hems for extra durability. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 6’0” and is wearing a medium
  • Standard fit
  • Fits true to size

Fabric & Care

  • 5.4 oz. 100% cotton
  • 1x1 rib knit collar and shoulder-to-shoulder taping
  • Double-needle hem
  • Imported
  • Machine wash cold

About This Design

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.7 out of 5 stars rating31.8K Total Reviews
24883 total 5-star reviews4877 total 4-star reviews1083 total 3-star reviews483 total 2-star reviews448 total 1-star reviews
31,774 Reviews
Reviews for similar products
5 out of 5 stars rating
By Barry M.December 10, 2019Verified Purchase
Basic T-Shirt, White, Adult XL
Zazzle Reviewer Program
I really like the shirt..met my expectations. Have already referred Zazzle to others have, in kind, ordered from Zazzle. I also really liked the blanket with photo’s of our pets that I surprised my wife with for her birthday.
5 out of 5 stars rating
By jelica d.July 8, 2019Verified Purchase
Value T-Shirt, White, Adult XL
Creator Review
Great colors my dear shirts. My creation is realistic, bravo
5 out of 5 stars rating
By E.May 1, 2013Verified Purchase
Basic Dark T-Shirt, Navy Blue, Adult L
Zazzle Reviewer Program
I figured since I got the cheapest of the shirt that it wouldn't hold up to the environment I was going to be in when wearing it. The shirt was soft and the fabric not too thin or too thick and more durable then I would have expected. The colors were good...I would have thought that they would have been a little more vibrant...the colors probably had more to do with the colors of the design then anything but over all I kind of thought it was cool that the printing on the shirt was basically "inked" into the fabric instead of the usage of fabric paint which usually can get warped and crinkled.

Tags

T-Shirts
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary
All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256979745856406409
Created on: 3/28/2025, 4:14 AM
Rating: G