Tap / click on image to see more RealViewsTM
Sale Price $19.36.  
Original Price $24.20 Comp. value
per shirt
You save 20%

Guardian Ancestor Hypatia, Men's T-Shirt

Qty:
Value T-Shirt
+$1.50
+$1.50
+$12.20
Black
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Men's Value T-Shirt

This classic silhouette is an affordable alternative heavyweight t-shirt for the value-conscious consumer. Rest assured as this t-shirt is pre-shrunk and made from 100% cotton. It also has double-needle stitched bottom and hems for extra durability. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 6’0” and is wearing a medium
  • Standard fit
  • Fits true to size

Fabric & Care

  • 5.4 oz. 100% cotton
  • 1x1 rib knit collar and shoulder-to-shoulder taping
  • Double-needle hem
  • Imported
  • Machine wash cold

About This Design

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia, Men's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.7 out of 5 stars rating31.6K Total Reviews
24726 total 5-star reviews4867 total 4-star reviews1067 total 3-star reviews471 total 2-star reviews429 total 1-star reviews
31,560 Reviews
Reviews for similar products
5 out of 5 stars rating
By Barry M.December 10, 2019Verified Purchase
Basic T-Shirt, White, Adult XL
Zazzle Reviewer Program
I really like the shirt..met my expectations. Have already referred Zazzle to others have, in kind, ordered from Zazzle. I also really liked the blanket with photo’s of our pets that I surprised my wife with for her birthday.
5 out of 5 stars rating
By jelica d.July 8, 2019Verified Purchase
Value T-Shirt, White, Adult XL
Creator Review
Great colors my dear shirts. My creation is realistic, bravo
4 out of 5 stars rating
By F.October 7, 2012Verified Purchase
Value T-Shirt, White, Adult XL
Creator Review
For me it ran a little big but thats good, neck line is a bit too wide but overall good for my needs. Just needs somthing to inspire me to work at what I do. Overall it came out great looks a little off centered but good for what I need it for.

Tags

T-Shirts
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary
All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256979745856406409
Created on: 3/28/2025, 4:14 AM
Rating: G