Tap / click on image to see more RealViewsTM
Sale Price $21.85.  
Original Price $25.70 Comp. value
per shirt
You save 15%

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Basic T-Shirt
+$10.10
+$25.05
+$11.00
Black
Classic Printing: No Underbase
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft - a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5’7” and is wearing a small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.6 out of 5 stars rating14.9K Total Reviews
10568 total 5-star reviews2865 total 4-star reviews831 total 3-star reviews386 total 2-star reviews252 total 1-star reviews
14,902 Reviews
Reviews for similar products
5 out of 5 stars rating
By eunice y.October 21, 2021Verified Purchase
Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
This Product Included Many Of My Immediate Family Members & We All Love The Excellent Quality Work Put Into Our T-Shirts & The Pricing!!! As Always Zazzle Does Excellent Quality Work On Everything We Have Ever Ordered Including Our Past Orders Our Beautiful Blankets!!
5 out of 5 stars rating
By Yuliya U.May 10, 2022Verified Purchase
Basic T-Shirt, Black, Adult S
Zazzle Reviewer Program
Perfect memorable good quality gift for any occasion. Colors turned out like expected I ordered black t-shirt with pink prints
5 out of 5 stars rating
By Lisa K.September 28, 2022Verified Purchase
Basic T-Shirt, White, Adult S
Creator Review
I bought each of my kids a t-shirt and they did not disappoint. I would probably buy them the black shirt next time or a better quality as my daughter loves her and has almost worn it out already. Printing is great. Could be a little darker but its cool.

Tags

T-Shirts
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary
All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Created on: 3/28/2025, 4:19 AM
Rating: G