Tap / click on image to see more RealViewsTM
Sale Price $3.24.  
Original Price $4.05 Comp. value
per sticker
You save 20%

Halloween Black Cat Shaped Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 3" x 3" Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 3" L x 3.5" H
  • Design Area: 3" L x 3" H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.125" border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Halloween Black Cat Shaped Sticker

Halloween Black Cat Shaped Sticker

This awesome shaped sticker design features a black cat with pointed ears, bright green eyes and a sly red grin. This creepy kitty is perfect for Halloween or for cat lovers.

Customer Reviews

4.9 out of 5 stars rating36 Total Reviews
34 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
36 Reviews
Reviews for similar products
5 out of 5 stars rating
By Debra S.July 10, 2024Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.
5 out of 5 stars rating
By GINA A.July 27, 2020Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The sticker paper is sturdy, the colors are vibrant, and the adhesive is strong. Sticker is exactly what I wanted. Perfect for me to express both sides of my personality, cute and creepy, every day. Very satisfied with my purchase! The image is clear and cleans. The colors are vibrant.
5 out of 5 stars rating
By r.April 28, 2025Verified Purchase
Extra-Small 3" x 3" Sheet Custom-Cut Vinyl Stickers, Glossy White
I bought a couple of glossy stickers, and they turned out great. The quality and design are on point.

Tags

Custom-Cut Vinyl Stickers
catshalloweenblackevilcreepykittyfamiliarvectorspetsanimals
All Products
catshalloweenblackevilcreepykittyfamiliarvectorspetsanimals

Other Info

Product ID: 256138886221653343
Created on: 6/14/2019, 5:55 AM
Rating: G