• Events
Tap / click on image to see more RealViewsTM
Sale Price $17.90.  
Original Price $21.05 Comp. value
per mug
You save 15%

Happy Bee Mug

Qty:
  1. Style

  2. Size

  3. Color: Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich color. Match or complement the color of your existing dinnerware set, or gift your friend a mug in his or her favorite color.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19563 total 5-star reviews1853 total 4-star reviews344 total 3-star reviews157 total 2-star reviews284 total 1-star reviews
22,201 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sol F.December 4, 2024Verified Purchase
Classic Mug, 11 oz
I love these cups!! I'm glad I ordered them and would definitely order from here again. I got 50 cups and they came within a reasonable time frame.
5.0 out of 5 stars rating
5 out of 5 stars rating
By DALAL R.January 14, 2020Verified Purchase
Combo Mug, 11 oz
Creator Review
This is a gorgeous mug that makes me feel as though I am outdoors in my Hosta garden, on a beautiful day in Spring! The printing is lovely and sharp just like my painting. I shall be displaying this mug at an exhibition soon!
5.0 out of 5 stars rating
5 out of 5 stars rating
By BaylieNovember 18, 2021Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
I ordered this as a Christmas gift to my boss that just rescued such a sweet puppy! The gift arrived almost a week earlier than expected. 10/10 would recommend! The print could’ve came out a little better, but I’m happy with it.

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Created on: 1/14/2009, 3:41 PM
Rating: G