Tap / click on image to see more RealViewsTM
Sale Price $15.75.  
Original Price $21.00 Comp. value
per mug
You save 25% ends today

Happy Bee Mug

Qty:
Combo Mug
-$2.05
-$1.00
+$3.10
+$4.15
+$6.20
+$8.25
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich color. Match or complement the color of your existing dinnerware set, or gift your friend a mug in his or her favorite color.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating21.6K Total Reviews
19114 total 5-star reviews1836 total 4-star reviews320 total 3-star reviews133 total 2-star reviews206 total 1-star reviews
21,609 Reviews
Reviews for similar products
5 out of 5 stars rating
By RATNA D.January 14, 2020Verified Purchase
Combo Mug, 11 oz
Creator Review
This is a gorgeous mug that makes me feel as though I am outdoors in my Hosta garden, on a beautiful day in Spring! The printing is lovely and sharp just like my painting. I shall be displaying this mug at an exhibition soon!
5 out of 5 stars rating
By Tina B.February 8, 2019Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
This mug turned out exactly as I ordered it! I love it! Shipping was very fast, too. The printing and colors were just as I ordered. Could not be happier with it!
5 out of 5 stars rating
By Kathy B.May 31, 2018Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
I was thrilled this came out so well. It is a very attractive mug with the colored handle and interior. Being able to personalize it was easy! It was designed for an end of the year thank you gift to the special recipient. perfect. Text lines up perfectly parallel to the top edge of the mug.

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Created on: 1/14/2009, 3:41 PM
Rating: G