Tap / click on image to see more RealViewsTM
Sale Price $17.90.  
Original Price $21.05 Comp. value
per mug
You save 15%

Happy Bee Mug

Qty:
Combo Mug
-$2.10
-$1.00
+$3.10
+$4.10
+$7.45
+$12.70
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich color. Match or complement the color of your existing dinnerware set, or gift your friend a mug in his or her favorite color.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating21.9K Total Reviews
19375 total 5-star reviews1844 total 4-star reviews335 total 3-star reviews152 total 2-star reviews239 total 1-star reviews
21,945 Reviews
Reviews for similar products
5 out of 5 stars rating
By RATNA D.January 14, 2020Verified Purchase
Combo Mug, 11 oz
Creator Review
This is a gorgeous mug that makes me feel as though I am outdoors in my Hosta garden, on a beautiful day in Spring! The printing is lovely and sharp just like my painting. I shall be displaying this mug at an exhibition soon!
5 out of 5 stars rating
By Cassie C.January 5, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
My sisters and Mom and I love Christmas and the Holiday season in general, so I thought how perfect to be able to personalize one of our fave Holiday movies! They came out beautifully and my sisters and Mom were very touched! See for yourself in my picture attached! 2 out of 4 were Perfect! The printing turned out badly for 2 of 4 and they were also broken in shipping. Zazzle was amazing and shipped out 2 new replacements that were perfect!! So 4 out of 4 were perfect! Excellent customer service!!
5 out of 5 stars rating
By Michele F.June 19, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Super happy with the results! I ordered this coffee mug for my husband, as a gift from our fur Babies 🐕‍🦺🦮 I am so pleased with the quality of this coffee mug as well as the sentimental value it now has!! My husband was also moved by this gift. (Nala & Rocky are seniors now and have had some health issues recently) Overall I am very pleased and recommend ordering this for you family/loved one!! Amazing! Just like the photos

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Created on: 1/14/2009, 3:41 PM
Rating: G