Tap / click on image to see more RealViewsTM
Sale Price $17.85.  
Original Price $21.00 Comp. value
per mug
You save 15%

Happy Bee Mug

Qty:
Combo Mug
-$2.05
-$1.00
+$3.10
+$4.15
+$6.20
+$8.25
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich color. Match or complement the color of your existing dinnerware set, or gift your friend a mug in his or her favorite color.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating21.8K Total Reviews
19280 total 5-star reviews1841 total 4-star reviews333 total 3-star reviews143 total 2-star reviews227 total 1-star reviews
21,824 Reviews
Reviews for similar products
5 out of 5 stars rating
By RATNA D.January 14, 2020Verified Purchase
Combo Mug, 11 oz
Creator Review
This is a gorgeous mug that makes me feel as though I am outdoors in my Hosta garden, on a beautiful day in Spring! The printing is lovely and sharp just like my painting. I shall be displaying this mug at an exhibition soon!
5 out of 5 stars rating
By Tina B.February 8, 2019Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
This mug turned out exactly as I ordered it! I love it! Shipping was very fast, too. The printing and colors were just as I ordered. Could not be happier with it!
5 out of 5 stars rating
By Michele F.June 19, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Super happy with the results! I ordered this coffee mug for my husband, as a gift from our fur Babies 🐕‍🦺🦮 I am so pleased with the quality of this coffee mug as well as the sentimental value it now has!! My husband was also moved by this gift. (Nala & Rocky are seniors now and have had some health issues recently) Overall I am very pleased and recommend ordering this for you family/loved one!! Amazing! Just like the photos

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Created on: 1/14/2009, 3:41 PM
Rating: G