Tap / click on image to see more RealViewsTM
Sale Price $21.85.  
Original Price $25.70 Comp. value
per shirt
You save 15%

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

Qty:
Basic Dark T-Shirt
-$1.50
+$10.70
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark color t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 6’2” and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

Heavy Weights And Protein Shakes Workout Gym Fitne T-Shirt

This cute Workout design also affects Gym & Fitness! It has to do with Training and also Motivation. Funny gift for Christmas or a birthday. Funny Heavy Weights And Protein Shakes present. Sport: The cool Weightlifting design is related to Bodyweight and Weightlifter! It also relates to Bodybuilder.

Customer Reviews

4.7 out of 5 stars rating31.9K Total Reviews
24996 total 5-star reviews4881 total 4-star reviews1091 total 3-star reviews487 total 2-star reviews450 total 1-star reviews
31,905 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Dark haired male wore adult large and 5’9”, 110# female wore adult medium . Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back.
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Grandma wore adult large with long sleeve shirt underneath. Tall girl adult medium. Dark haired male adult large. Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back.
5 out of 5 stars rating
By Jenny S.September 9, 2025Verified Purchase
Value T-Shirt, Black, Adult S
My 11 yo wore adult XL (5’7” 165#). The 8yo is small framed. She wore adult small and tied it in the back. Dark haired male wearing adult large and female wearing adult medium. Good quality dark Heather gray, Gildan brand shirt. -it was next up from basic choice and cost about $20 per shirt. Not too thick or thin. Washed and dried well, no major shrinkage. Not see-through. Can wear a bra under it fine. Screen print is just as shown and well done, front and back. They printed random cupcake image I downloaded from internet with no problems! Looked perfect! Front design was stock from zazzel.

Tags

T-Shirts
alsodesignfunnybodybuilderproteinshakesweightliftingweightsheavyfitness
All Products
alsodesignfunnybodybuilderproteinshakesweightliftingweightsheavyfitness

Other Info

Product ID: 235308221130654641
Created on: 9/30/2021, 5:58 PM
Rating: G