Tap / click on image to see more RealViewsTM
$36.20
per hat
 

Hows the sauce? Hat

Qty:
Distressed Adjustable Cap
-$1.35
-$5.30
Scotland Blue

Other designs from this category

About Embroidered Hats

Sold by

Style: Distressed Adjustable Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and color may vary
  • Care Instructions : Machine wash cold. Non-chlorine bleach, when needed. Tumble dry medium. Do not iron decorations/customization.

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

Hows the sauce? Hat

Hows the sauce? Hat

Support Rankin’s Food reviews love of iced tea with this hat.

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
954 total 5-star reviews137 total 4-star reviews41 total 3-star reviews9 total 2-star reviews11 total 1-star reviews
1,152 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Innocent P.October 1, 2021Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stephen L.November 1, 2015Verified Purchase
Embroidered Hat, Basic Adjustable Cap
Zazzle Reviewer Program
Excellent quality hat. Love Yahuwah in Paleo Hebrew with white letters! Great stitch work, sturdy, durable hat. I really like the Scotland Blue color and the Distressed Chino is 100% Cotton! Looks great! The design and quality were excellent.
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.April 25, 2012Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
These are really well made hats. The destressed look is really well done with an extra layer of material that is 'distressed' with and intact layer of material underneath so you don't get the brim material showing through. This extra material, I would guess, accounts for the added cost of the distressed type hats. Well worth the price for this really well made hat. As a side note; if you have a big head this hat will fit you too. I'm 6'-5" and 300lbs. and a big old head. Fits well. Not stiff. Arrived fast. Embroidery is solid and is exactly as represented in the photos on Zazzle. Looks great and not a stitch out of place.

Tags

Embroidered Hats
hathatsballcapcaprankinrankinsreviewsrankinsfoodreviews
All Products
hathatsballcapcaprankinrankinsreviewsrankinsfoodreviews

Other Info

Product ID: 256068027725727860
Created on: 9/27/2024, 6:10 AM
Rating: G