Tap / click on image to see more RealViewsTM
$36.20
per hat
 

Hows the sauce? Hat

Qty:
District Threads Distressed Chino Twill Cap
-$1.35
-$5.30
Scotland Blue

Other designs from this category

About Embroidered Hats

Sold by

Style: District Threads Distressed Chino Twill Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and color may vary
  • Care Instructions : Machine wash cold. Non-chlorine bleach, when needed. Tumble dry medium. Do not iron decorations/customization.

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

Hows the sauce? Hat

Hows the sauce? Hat

Support Rankin’s Food reviews love of iced tea with this hat.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
951 total 5-star reviews137 total 4-star reviews41 total 3-star reviews9 total 2-star reviews10 total 1-star reviews
1,148 Reviews
Reviews for similar products
5 out of 5 stars rating
By Innocent P.October 1, 2021Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
5 out of 5 stars rating
By M.March 7, 2020Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Zazzle Reviewer Program
I bought this hat to because it appealed to me as a creature of the night who also works to save lives in medial emergencies. I was not disappointed and will wear it with pride as I go about my nocturnal EMS activities. Thank you to Urban Nymph Market for filling this huge gap in EMS apparel for those who consume blood instead of Diet Cola or coffee during the long, arduous night shifts. The embroidery was crisp and clean
5 out of 5 stars rating
By Stephen L.November 1, 2015Verified Purchase
Embroidered Hat, Alternative Apparel Basic Adjustable Cap
Zazzle Reviewer Program
Excellent quality hat. Love Yahuwah in Paleo Hebrew with white letters! Great stitch work, sturdy, durable hat. I really like the Scotland Blue color and the Distressed Chino is 100% Cotton! Looks great! The design and quality were excellent.

Tags

Embroidered Hats
hathatsballcapcaprankinrankinsreviewsrankinsfoodreviews
All Products
hathatsballcapcaprankinrankinsreviewsrankinsfoodreviews

Other Info

Product ID: 256068027725727860
Created on: 9/27/2024, 6:10 AM
Rating: G