Tap / click on image to see more RealViewsTM
Sale Price $21.85.  
Original Price $25.70 Comp. value
per pillowcase
You save 15%

Hummingbird Birds Wildlife Flowers Pillowcase

Qty:
Standard
Single Pillowcase

Other designs from this category

About Pillowcases

Sold by

Set Size: Single Standard Size Pillowcase

Doze off in serious style with a one-of-a-kind pillowcase. Create a luxourious getaway with this super soft and cozy pillowcase. Counting sheep has never been easier, and sleep never ever felt soooo good.

  • Standard pillowcase dimensions: 20"h x 30"w
  • Made from 100% soft microfiber polyester
  • High quality sublimation printing allows for vibrant color
  • Double-sided printing available for additional upcharge
  • Pillowcase is printed before being sewn, allowing for beautiful edge-to-edge printing
  • Machine wash/dry
  • Pillow not included
  • Proudly made in the USA

About This Design

Hummingbird Birds Wildlife Flowers Pillowcase

Hummingbird Birds Wildlife Flowers Pillowcase

Gorgeous collage of vintage botanical fine art of exotic tropical Hummingbird Birds and Flowers is on this Pillowcase. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.9 out of 5 stars rating226 Total Reviews
212 total 5-star reviews9 total 4-star reviews3 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
226 Reviews
Reviews for similar products
5 out of 5 stars rating
By Greg R.February 19, 2020Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
My girlfriend nearly cried when she opened the package. Very custom and from the heart. I will order more. The printing is beautiful! And the pillowcase fabric is high quality. Very impressive.
5 out of 5 stars rating
By Leigh F.January 24, 2018Verified Purchase
Single Pillowcase, Standard Size
Creator Review
This is an outstanding easy-care pillow case, well sewn, and the microfiber fabric is marvelous. I made this pair as part of a Farm House Chic Collection ensemble. In my photos the cases have been washed and slept on a week. They look great. The wrinkles smooth right out in the morning. This fabric, though a polyester, does not take up color the same as the polyester cushions. I will be ordering more pillowcases in other colors and their intended pillow mates to see how the color variations between fabric type best go together in various ensembles. I cannot fault this printing- clearly it is a fine reproduction, but the color is quite different than the image, whereas the complement throw pillow using a pattern variation of the same image color matches the image. Fortunately, since I planned an ensemble with many shades of greens in the blanket leaves, various items in the group harmonize.
5 out of 5 stars rating
By Diana J.August 21, 2024Verified Purchase
Pair of Pillowcases, Standard Size
Creator Review
Standard, Pair of Standard Size Pillowcases. Printing turn out good

Tags

Pillowcases
flowershummingbirdsbirdsanimalswildlifevintagepillowcasehummingbirds pillowcasetropicalfloral pillowcase
All Products
flowershummingbirdsbirdsanimalswildlifevintagepillowcasehummingbirds pillowcasetropicalfloral pillowcase

Other Info

Product ID: 256412253017643672
Created on: 3/13/2018, 7:09 AM
Rating: G