Tap / click on image to see more RealViewsTM
Sale Price $10.89.  
Original Price $18.15 Comp. value
per wall decal
You save 40%

I Love Checkers Heart Decal Checkerboard B/W

Qty:
Single
Heart
Left

Other designs from this category

About Wall Decals

Sold by

Number of Shapes: Walls 360 Custom Wall Decal

Brighten up any room with a custom wall decal from Zazzle and Walls 360! Printed with premium eco-solvent inks on high quality fabric paper, your images, text, and designs will pop off the wall with stunning clarity and color accuracy. Made to be moved, each wall decal can be peeled and repeeled up to one hundred times without damaging the decal or walls. No glue, no frames, no pain – make a space all your own with a customized wall decal!

  • Brilliant high-resolution printing on self-adhesive fabric paper.
  • Easy peel and restick up to 100 times. No wall damage or sticky residue.
  • Manufactured by Walls 360 in Las Vegas, Nevada.
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

I Love Checkers Heart Decal Checkerboard B/W

I Love Checkers Heart Decal Checkerboard B/W

I Love Checkers Heart Decal by Jasmine - CricketDiane Art and Design 2014 - black and white checkerboard design

Customer Reviews

4.8 out of 5 stars rating132 Total Reviews
117 total 5-star reviews13 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
132 Reviews
Reviews for similar products
5 out of 5 stars rating
By Angie E.May 2, 2020Verified Purchase
12"x12" Square With Rounded Corners Wall Decal
Zazzle Reviewer Program
I was a little nervous to order wall decals because I used some back in the 80's and they were stick once and you couldn't really move them. These I bought from zazzle are FANTASTIC!! Easy to apply and move if your not happy where you placed them. Just like I wanted. They look perfect in my kitchen.
5 out of 5 stars rating
By J.April 13, 2016Verified Purchase
12"x12" Square Wall Decal
Zazzle Reviewer Program
Really pleased with this poster, everything i wanted. I came in good shape and looks as it did on the site i ordered it from. Can't wait to display it ! Very good quality paper and printing. The colors a very vivid. I love the it and i am very pleased !
5 out of 5 stars rating
By Peggy C.November 28, 2019Verified Purchase
12"x12" Square Wall Decal
Zazzle Reviewer Program
I was very pleased with the ease of use of this wall decal. Has been up for over 2 months and still in place. The decal was very clear and the printing and quality was exactly as I designed it

Tags

Wall Decals
cricketdianecheckerscheckerboardi love checkersgamesfriendsfriendshipwall decaldecorheart decal
All Products
cricketdianecheckerscheckerboardi love checkersgamesfriendsfriendshipwall decaldecorheart decal

Other Info

Product ID: 256490515789605228
Created on: 7/1/2014, 10:54 PM
Rating: G 
Related Searches
wall stickerwall decals