Tap / click on image to see more RealViewsTM
Sale Price $5.63.  
Original Price $6.25 Comp. value
per sticker
You save 10%

Inna Name Kiwi Design Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 4" x 4" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 4" L x 4.5" W
  • Design Area: 4" L x 4" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Inna Name Kiwi Design Sticker

Inna Name Kiwi Design Sticker

A very beautiful stylish personalized sticker / sticker in Kiwi design for Inna. The name as text is available in different sizes and also in transparent. Perfect for you, your best friend, wife, sister, mother, aunt, grandma, fiancée, cousin, partner or whatever you want to surprise with a personal and individual gift. Please check our shop for more products as a gift idea with this name. Here you will find many more personalized products and designs.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
899 total 5-star reviews65 total 4-star reviews27 total 3-star reviews29 total 2-star reviews82 total 1-star reviews
1,102 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jenn K.August 20, 2019Verified Purchase
6" x 6" Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Good quality vinyl stickers that stick well but also can be removed without residue. Funny eyes for all sorts of stuff. Printing turned out great and looks just as it appears online.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!

Tags

Custom-Cut Vinyl Stickers
firstnamebirthdayhappystickergiftkiwiinna
All Products
firstnamebirthdayhappystickergiftkiwiinna

Other Info

Product ID: 256744154195948825
Created on: 9/28/2021, 5:55 PM
Rating: G