Tap / click on image to see more RealViewsTM
Sale Price $17.68.  
Original Price $20.80 Comp. value
per towel
You save 15%

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 16" x 24"

Brighten up any kitchen with new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram, or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 16" x 24"
  • 80% durable woven polyester/ 20% polyamide blend microfiber
  • White-colored back-side is non-customizable
  • Machine washable
  • Imported, printed in the USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 24". For best results please add 5/7" bleed.

About This Design

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Cool collage of vintage botanical fine art of Kingfisher Alcedo Birds and Cattails at a pond is on this Kitchen Towel. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1014 total 5-star reviews118 total 4-star reviews37 total 3-star reviews13 total 2-star reviews16 total 1-star reviews
1,198 Reviews
Reviews for similar products
5 out of 5 stars rating
By Corinne D.February 7, 2018Verified Purchase
Kitchen Towel
Creator Review
My photos don’t do the colors of my gorgeous kitchen towel justice. It’s absolutely beautiful! The printing is gorgeous!
5 out of 5 stars rating
By Donald M.February 3, 2019Verified Purchase
Kitchen Towel
Creator Review
Ecstatic, Eccentric, Eclectic - Excellent, absorbent kitchen towels with vibrant designs. Excellent! Rich pure colors.
5 out of 5 stars rating
By Dee A.March 12, 2023Verified Purchase
Kitchen Towel
Creator Review
Zazzle's kitchen towels put the fun in functional! The waffle weave is absorbent. They are on the thinner side, and I like that because they're pliable and dry quickly. Impressive printing, colors are vibrant and true to expectations. Great detail, too.

Tags

Kitchen Towels
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds
All Products
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds

Other Info

Product ID: 197316344225007716
Created on: 7/14/2019, 7:23 AM
Rating: G