Tap / click on image to see more RealViewsTM
Sale Price $15.18.  
Original Price $17.85 Comp. value
per mug
You save 15%

Kingfisher Birds Wildlife Pond Animals Mug

Qty:
Classic Mug
+$1.00
+$1.95
+$4.85
+$5.80
+$9.00
+$13.90

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Kingfisher Birds Wildlife Pond Animals Mug

Kingfisher Birds Wildlife Pond Animals Mug

Gorgeous collage of vintage botanical fine art of exotic Kingfisher Birds and pond habitat by Gould is on this Mug. Images are public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating21.9K Total Reviews
19322 total 5-star reviews1842 total 4-star reviews333 total 3-star reviews146 total 2-star reviews230 total 1-star reviews
21,873 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.May 16, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Got a personalized coffee mug for my husband as a birthday gift from our kids. He lovessss it!! Turned out really nice! The pictures were really clear!! Great product!! The pictures were really clear!!! They turned out great!!
5 out of 5 stars rating
By Maureen Z.May 8, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
It is a lovely mug. The actual mug is shiny and smooth. Very nice quality. It was everything I expected. Zazzle has so many nice mid century modern designs to choose from. All so pretty! The design was very clear and looked expensive.
5 out of 5 stars rating
By A.October 19, 2021Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
I love the mug, it is Awesome looking! 😊 I bought this mug to give to my uncle for Christmas. He has a 57 Chevy that is the same color as this 57 Chevy on this mug. He's going to love this mug! 😊 Thank You So Much!!! 😊. Awesome Mug!!! The printing of the 57 Chevy looks Awesome!!! 😊

Tags

Mugs
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage
All Products
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage

Other Info

Product ID: 168527610128357298
Created on: 10/11/2016, 2:11 AM
Rating: G