Tap / click on image to see more RealViewsTM
Sale Price $15.18.  
Original Price $17.85 Comp. value
per mug
You save 15%

Kingfisher Birds Wildlife Pond Animals Mug

Qty:
Classic Mug
+$0.95
+$1.95
+$4.85
+$5.80
+$7.75
+$9.65

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Kingfisher Birds Wildlife Pond Animals Mug

Kingfisher Birds Wildlife Pond Animals Mug

Gorgeous collage of vintage botanical fine art of exotic Kingfisher Birds and pond habitat by Gould is on this Mug. Images are public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating21.8K Total Reviews
19241 total 5-star reviews1838 total 4-star reviews329 total 3-star reviews142 total 2-star reviews224 total 1-star reviews
21,774 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.May 16, 2020Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
Got a personalized coffee mug for my husband as a birthday gift from our kids. He lovessss it!! Turned out really nice! The pictures were really clear!! Great product!! The pictures were really clear!!! They turned out great!!
5 out of 5 stars rating
By Maureen Z.May 8, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
It is a lovely mug. The actual mug is shiny and smooth. Very nice quality. It was everything I expected. Zazzle has so many nice mid century modern designs to choose from. All so pretty! The design was very clear and looked expensive.
5 out of 5 stars rating
By Chayt C.October 5, 2020Verified Purchase
Two-Tone Mug, 15 oz
Zazzle Reviewer Program
The mug feels really nice; it's kind of heavy, which I like. It was made, shipped and arrived within eight days of when I completed my order. Two corners of the box were smushed, but that's most likely the fault of the postal service or my little brother, not Zazzle, and the mug itself was perfectly intact. It was a bit dirty when I opened the box but that was expected and easy to clean off. I love it! The photo I added was perfect and everything lined up just as I expected; the only issue I found is that the heart on it turned out closer to off-white, when I was expecting more of a light grey, but other than that it's wonderful.

Tags

Mugs
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage
All Products
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage

Other Info

Product ID: 168527610128357298
Created on: 10/11/2016, 2:11 AM
Rating: G